SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000002309 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000002309
Domain Number 1 Region: 210-267
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 266-323
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.57e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 322-379
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.7e-23
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 4 Region: 434-491
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.88e-22
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 378-435
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.56e-22
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 6 Region: 476-528
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.94e-21
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 7 Region: 9-70
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.49e-20
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 8 Region: 159-211
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.46e-16
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000002309   Gene: ENSFCAG00000002509   Transcript: ENSFCAT00000002509
Sequence length 533
Comment pep:novel genescaffold:CAT:GeneScaffold_4754:520596:547942:1 gene:ENSFCAG00000002509 transcript:ENSFCAT00000002509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGFRTASCWGLLSFKDISMEFTWDEWQLLDSAQKYLYRDVILENYSHLVSVXXXXXXX
DLIFKLEQGEEPWIINAKVSRQSCPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXNSGSTRNCLRKNPDKFHGYEESYFLKHQRAHGIEKNCVCNECG
KAFRCKSQLIVHLRIHTGERPYECTKCERAFSAKSNLNAHQRVHTGEKPYSCSECGKVFS
FRSQLIVHQEIHTGGKPYGCSDCGKAYSWKSQLILHQRSHTGVKPYECGECGKAFSLKSP
FVVHQRTHTGVKPHKCSECGKAFRSKSYLLVHIRMHTGEKPYQCGDCGKAFNMKTQLVVH
QGIHTGNNPYQCGECGKAFGRKEQLTAHLRAHAGEKPYGCSECGKAFSSKSYLVIHRRTH
TGERPYECSFCERAFCGKSQLIIHQRTHSTEKPYECSECEKAYPRKASLQIHQKTHSGEK
PFKCSECGKAFTQKSSLSEHQRVHTGEKPWKCSECGKSFCWNSGLRIHRKTHK
Download sequence
Identical sequences 9685.ENSFCAP00000002309 ENSFCAP00000002309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]