SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000002405 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000002405
Domain Number 1 Region: 2-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.62e-26
Family KRAB domain (Kruppel-associated box) 0.00093
Further Details:      
 
Domain Number 2 Region: 520-577
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.84e-25
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 3 Region: 277-334
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-23
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 4 Region: 333-390
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.53e-22
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 5 Region: 478-530
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.69e-20
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 6 Region: 566-618
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.11e-20
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 7 Region: 239-291
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-17
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 8 Region: 375-425
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000011
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 9 Region: 418-469
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000381
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 10 Region: 184-250
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000128
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000002405
Domain Number - Region: 100-138
Classification Level Classification E-value
Superfamily Translation initiation factor 2 beta, aIF2beta, N-terminal domain 0.0994
Family Translation initiation factor 2 beta, aIF2beta, N-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000002405   Gene: ENSFCAG00000002610   Transcript: ENSFCAT00000002610
Sequence length 623
Comment pep:novel scaffold:CAT:scaffold_150589:35674:41164:1 gene:ENSFCAG00000002610 transcript:ENSFCAT00000002610 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESVTFKDVAVDFTQEEWHHVDPAQRRLYRDVMLENYSHLVSLGYQVSKPEVIFKLEQGEE
PWISEGEIQRPFCPDWKTRPEGKSSHLQQSVSEGSRSADGLSRATFENTWDVSSQLERHQ
ENWKRYLGPDASTQKKTITPEENIQQNKFGENPRLNTVLVTQLNVPSRPSECDTLGSNLG
QNSDIINQSNILAKKKPYKCDKCRKAFIHRSSLTKHEKTHKGEGACPNGTDQGIYPGKKH
HECTDCGKTFLWKTQLTEHQRIHTGEKPFECNVCGKAFRHSSSLGQHENAHTGEKPYQCS
LCGKAFQRSSSLVQHQRIHTGEKPYRCNLCGRSFRHGTSLTQHEVTHSGEKPFQCKECGK
AFSRCSSLVQHERTHTGEKPFECSICGRAFGQSPSLYKHMRIHKRGKPYQSNNYSVDFKH
SSSLTQDESTVNEVKSYHCNDCGEDFSHITDFTDHQRIHTGQNPYECEQNFNQQPVSHPG
EKPYQCNVCGKAFKRSTSFIEHHRIHTGEKPYECNECGEAFSRRSSLTQHERTHTGEKPY
ECIDCGKAFSQSSSLIQHERTHTGEKPYECNECGRAFRKKTNLHDHQRIHTGEKPYACKE
CGKNFSRSSALTKHQRIHTRNKL
Download sequence
Identical sequences 9685.ENSFCAP00000002405 ENSFCAP00000002405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]