SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000002777 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000002777
Domain Number 1 Region: 357-414
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.06e-24
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 2 Region: 9-70
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.63e-24
Family KRAB domain (Kruppel-associated box) 0.00083
Further Details:      
 
Domain Number 3 Region: 301-358
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.72e-23
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 4 Region: 413-470
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.74e-22
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 5 Region: 455-507
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.66e-21
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 6 Region: 263-315
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.52e-20
Family Classic zinc finger, C2H2 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000002777
Domain Number - Region: 205-241
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00134
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000002777   Gene: ENSFCAG00000003016   Transcript: ENSFCAT00000003016
Sequence length 573
Comment pep:novel genescaffold:CAT:GeneScaffold_631:14465:22468:1 gene:ENSFCAG00000003016 transcript:ENSFCAT00000003016 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATKLLTARSHALVTFKDVLVNFTREEWKLLDTAQQIMYKDVMLENYKNLVSLGHQLPKP
DVILQLEKGEEPWLVERGTHRETHPDLDTAVEIKSSVSSKSISKDKQSYGIKMEGIPKND
LWYLSLEEVWKCEDQLDKYQENQERHLRQVAFTQKKALTQERVCENGKYGGNCLLPAQLV
LREYFHKHDSHTKSLKHNLVFSGHQESYASNSSECGQTFCQNIHLIQFARTQPGDKSYKC
PDTVNSLTGGTSLGVSKGIHREKPYECKECGKFFSWRSNLTRHRLIHTGEKPYECKECGK
SFSRSSHLIGHQKTHTGEEPYECKECGKSFSWFSHLVTHQRTHTGDKLYTCSQCGKSFVH
SSRLIRHQRTHTGEKPYECPECGKSFRQSTHLILHQRTHVRVRPYECNECGKSYSQRSHL
VVHHRTHTGLKPFECKDCGKCFSRSSHLFSHQRTHTGEKPYECHDCGKSFSQSSALIVHQ
RIHTGEKPYECCQCGKAFIRKNDLIKHQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXFQTNPIRENIY
Download sequence
Identical sequences ENSFCAP00000002777 9685.ENSFCAP00000002777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]