SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000003101 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000003101
Domain Number 1 Region: 1195-1397
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.64e-47
Family Laminin G-like module 0.00027
Further Details:      
 
Domain Number 2 Region: 1664-1860
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-37
Family Laminin G-like module 0.000000466
Further Details:      
 
Domain Number 3 Region: 1450-1658
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.21e-30
Family Laminin G-like module 0.00055
Further Details:      
 
Domain Number 4 Region: 312-379
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 5.13e-17
Family Ovomucoid domain III-like 0.0097
Further Details:      
 
Domain Number 5 Region: 17-87
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000485
Family Ovomucoid domain III-like 0.0047
Further Details:      
 
Domain Number 6 Region: 395-444
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000818
Family Ovomucoid domain III-like 0.0064
Further Details:      
 
Domain Number 7 Region: 745-814
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000025
Family Ovomucoid domain III-like 0.0067
Further Details:      
 
Domain Number 8 Region: 93-163
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000624
Family Ovomucoid domain III-like 0.0064
Further Details:      
 
Domain Number 9 Region: 991-1066
Classification Level Classification E-value
Superfamily SEA domain 0.000000000000759
Family SEA domain 0.0031
Further Details:      
 
Domain Number 10 Region: 540-594
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000333
Family Ovomucoid domain III-like 0.0042
Further Details:      
 
Domain Number 11 Region: 462-509
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000388
Family Ovomucoid domain III-like 0.0088
Further Details:      
 
Domain Number 12 Region: 185-235
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000762
Family Ovomucoid domain III-like 0.011
Further Details:      
 
Domain Number 13 Region: 637-680
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000159
Family Laminin-type module 0.0051
Further Details:      
 
Domain Number 14 Region: 691-729
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000419
Family Laminin-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000003101
Domain Number - Region: 1390-1425
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00548
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000003101   Gene: ENSFCAG00000003363   Transcript: ENSFCAT00000003363
Sequence length 1871
Comment pep:novel genescaffold:CAT:GeneScaffold_5080:183609:204663:1 gene:ENSFCAG00000003363 transcript:ENSFCAT00000003363 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KPGTHFTPAPPVPPDACRGMLCGFGAVCEPSAEGSGRASCVCKKSACPAVVAPVCGSDAS
TYSNECELQRAQCSQQRRIRLLSRGPCGSRDPCSNVTCSFGSTCVRSADGQTATCLCPAT
CRGPPDGPVCGSDGADYPSECQLLRHACARQENIFKKFDGPCDPCQSARSDLSRICRVNP
RTRRPEMLLRPESCPPRQAPVCGDDGVTYDNDCTMGRTGAARGLLLQKVRSGQCQPXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRAIPAK
HQGPCDQPLSPCLGVQCPFGAACAVKNGEAECVCQQACSGIYDPVCGSDGVTYGSTCELE
ATACTLGREIRVARRGPCDRCGQCRFGALCEAETGRCVCPSECVALAQPVCGSDGHTYAS
ECELHVHACTHQISLRVVSAGRCQTCGDTVCAFGAVCLAGRCVCPRCERPPPGPVCGSDG
VTYHSACELREAACQQQTRIEEARAGPCEQAECGSGGSGSGEDGECEQELCRQHGGVWDE
DSEDGPCVCDFSCQSVPRSPVCGSNGVTYGTECELKKARCELQRELYVAAQGTCRGPTLA
PLPPAVPPHCTQTPYGCCQDNITAARGVGLAGCPSSCHCNPHGSYSGTCDPATGQCSCRP
GVGGLKCDRCEPGFWNFRGIVTDGRSGCTPCSCDPRGAVRDDCEQMAGLCSCKPGVAGPK
CGQCPDGHTLGPAGCETDSLAPETCAEMRCEFGASCVEEAGSAHCVCPTPTCPEASATKV
CGSDGVTYGNECQLRTIACRQGLDISIQSLGPCQEAIASGARPTSPAPVATLGLNVSRAL
PPPPSALPLTPGSTPHSRPTPRPSPGPWTTARIPRTTTRPVLTMPPTAPATAPNLATSAF
GESGSADGSGDEELSGDLEASGTGSGGLEPPEGGSAVTPGPPLERASCYNSPLGCCSDGK
TPSLDTEGSNCPATKAFQGVLELEGVEGQELFYTPEMADPKSELFGETARSIESTLDDLF
RNSDVKKDFRSVRLRDLGPGSSVRAIVDVHFDPATTFRAPDVGQALLRQIQASRRRSLGV
RRPLQEHVRFMDFDWFPAFFTGATTGATPAAATARATTVAHLPSAVTQRALYPSHTSRPV
GRTTALPTTRQLPTTAPRHVPGRRPLPPGTQQPPRPCDSQPCLHGGTCRDQDSGGGFTCS
CPVGRRGDTCEKALQPSLPAFGGHSFLAFPTLRAYHTLRLALEFRTWEPQGLLLYNGNAR
GKDFLSLTLLGGRVQLRFDTGSGPAVLTSSVPVEPGRWHRLELSRHWRRGTLSVDGETPV
VGHSPSGTDGLNLDTDLFVGGVPADQASVVLERTSVSVGLKGCIRLLDINNQRLELSSWQ
GTVTRSSGVGECRDHPCLRRAPCQALQAGVFPCQCPPGRCGATCSDGENPCEPNPCHGAA
PCRVLPEGEAKCECPQGRGGALCQTVSKQDYPRPFLADFSGFSYLELEGLHTFARDLGEK
MALEVVFLARGPSGLLLYNGQKTDGKGDFVSLALHDRFLEFRYDLGKGAAVIRSKEPVAL
DTWTRVSLERSGRKGAMRVSDGPRVLGESPVPHTVLNLKEPLYVGGAPDFSKLARAAAVS
SGFDGVIQLVSLKGHQLLTQEHVLRAVDVSSSTHHPCTQASGHPCLNGASCLPREASYEC
LCPGGFSGLHCEGLIEKSAGDLDALAFDGQTYVEYLNAVTESEKAVRSNHFELSLRTEAT
QGLVLWSGKATERADYVALAIVDGRLQLTYDLGSQPVVLRSTVPVNTNRWLRVRAHREQR
EGSLQVGNEAPVTGSSPLGATQLDTDGALWLGGLEKPPMGQALPKAYSTGFVGCLRDVVV
GQRPLHLLEDA
Download sequence
Identical sequences ENSFCAP00000003101 9685.ENSFCAP00000003101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]