SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000003457 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000003457
Domain Number 1 Region: 425-482
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.74e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 313-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.11e-23
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 3 Region: 369-426
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.29e-20
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 4 Region: 34-91
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.11e-19
Family KRAB domain (Kruppel-associated box) 0.0018
Further Details:      
 
Domain Number 5 Region: 271-323
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.88e-19
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 6 Region: 469-527
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.86e-18
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000003457   Gene: ENSFCAG00000003751   Transcript: ENSFCAT00000003752
Sequence length 562
Comment pep:novel genescaffold:CAT:GeneScaffold_551:254271:268324:1 gene:ENSFCAG00000003751 transcript:ENSFCAT00000003752 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDFRRPDCHFATGVGPHRYCELERASRDPRRAGRKGLMAFEDVAVYFSQEEWELLDAAQR
ALYCHVMLENFALVSSLGLSASPRVVLQLERGEEPWVLSGTVVTPARNAQRKPSPVCMTV
VLEEAALPVTFNCSPSTYTGTCERGKSSVGWQGTSVSQEKKTTVVSIFGDRLLLIQSSGE
ATVNLLTSSLRTPQDDQPRDLAIIEALSPGQHPRTSDRKPYSEASSRVLPCIPDLEVNCA
GRKAGVDCEKPHGLPTSQEPPTWDQLGKALHTGEKPLECRACTKVFLKSSDLLKHLRTHT
GERPYECSQCGKAFSQTSHLTQHQRIHSGETPYACPACGKAFRHSSSLVRHQRIHTAEKS
FRCSECGKAFSHGSNLSQHRKIHAGGRPYACAQCGRRFCRNSHLIQHERTHTGEKPYTCA
LCGAAFSQGSSLFKHQRVHTGEKPFACTQCGRAFSHSSNLTQHQLLHTGERPFRCGDCGK
AFAKGAVLLSHRRIHTGEKPFVCTHCGRAFRERPALFHHQRIHTGEKRAATSACAPRPGL
LQGHHQRARWAELGPLPKPADA
Download sequence
Identical sequences 9685.ENSFCAP00000003457 ENSFCAP00000003457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]