SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000004135 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000004135
Domain Number 1 Region: 757-805
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000229
Family Laminin-type module 0.0099
Further Details:      
 
Domain Number 2 Region: 910-962
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000053
Family Laminin-type module 0.0031
Further Details:      
 
Domain Number 3 Region: 803-853
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000781
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 4 Region: 863-912
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000134
Family Laminin-type module 0.044
Further Details:      
 
Domain Number 5 Region: 709-759
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000335
Family Laminin-type module 0.005
Further Details:      
 
Domain Number 6 Region: 1020-1061
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000363
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 7 Region: 354-397
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000809
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 8 Region: 228-265
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000187
Family Laminin-type module 0.071
Further Details:      
 
Domain Number 9 Region: 1068-1115
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000698
Family Laminin-type module 0.027
Further Details:      
 
Domain Number 10 Region: 962-1017
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000725
Family Laminin-type module 0.0042
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000004135
Domain Number - Region: 395-432
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00307
Family Laminin-type module 0.036
Further Details:      
 
Domain Number - Region: 35-97
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0935
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000004135   Gene: ENSFCAG00000004479   Transcript: ENSFCAT00000004480
Sequence length 1687
Comment pep:novel genescaffold:CAT:GeneScaffold_974:444303:658009:-1 gene:ENSFCAG00000004479 transcript:ENSFCAT00000004480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GEQKCFICDSRFPYDPYTQSQSHTIENVITSFEPGRDKKWWQAENGLDHVSIRLDLEALF
QFSHLILTFKTFRPAAMLVERSTDYGHTWKVLKYFAKDCAASFPNITSGQAQGVGDLVCD
SKYSDIEPSSGGEVVLKVLDPRFEIENPYSPYIQDLVTLTNLRINFTXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVHGQCVCQHHTDGP
NCERCKGFFQDVPWRPAAGLQDSACRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCECDPDGTLSGGICVSHSDPALGSVA
GQCLCKENVEGAKCDQCKPNHHGLSAADPLGCQPCNCNPLRSLPFFTWDVKTGQCACQSF
ATGPHCEECTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXGSVTFGQVPAVHGVFREPVPGSPTAWTGPGFAR
VLPGAGLRFAVDHIALPMDFTIAIRYEIQVSNSSSSRILVNPLGKSKHCPRETPWPRPQS
FPLPATSRIVLLPTPICLEPDVQYSIDVYFSQALEGGAHAHSHILVDSLSLIPQINSLEN
FCSKQDLDEYHLHNCVDIALKAGPQMLPGACERLIVSMSARLNNGAVACKCHPQGSVGPN
CSRLGGQCQCKPHVAGRCCDRCSTGSYGLGHHGCHPCHCHPQGSKSAVCDQITGQCACQG
EVAGLRCDRCLASYFGFPNCRPCLCNGFAELCDPETGSCFNCGGFTTGRNCERCIDGYYG
DPPSGRSCRPCPCPDVPSSNQYFAHSCYQDPWSSDVICNCLQGYAGKQCGECSAGFYGNP
RISGAPCRPCACNNNIDVTDPESCSRVTGECLRCLHDTQGPNCQFCKPGHFGSAINQTCR
RCSCHPSGVTPAACPPGQGACLCDPNTGACPCLPNVTGQTCDRCADRYWNLVPGRGCQPC
NCDPRTSHSGHCDQLTGQCPCKLGYDGQHCSECKENYYGDPLGRCLPCDCNTEGTQKPVC
DQNTGMCRCREGVSGPRCDRCARGHGQEFPACLPCHRCFDQWDRAAASLSKAVQGLIGLA
ANTEDKTETLLVCEADFKGLRENMSEIERILKHPVFSSGEFLKAKDYQDSVREQIMQLSL
QLKAVHEFQDLKETMVRMKSEADLLFEDLRKEIDLRSRAHTANIMDPSETIKKHYQRSSS
AEKKITETTSIIKNSEKTRNDLHSMFDTLSSKENLSLEKLKQITVPDMQILIEKVCGVPG
DMPCVLPSCGDPSCRGSRTLSGHALQQAQEAETVIHNLSDQVQGWKNQXXXXXXXXXXXX
XXXXXLSEKLRNMKNQSESEEEKMSLLIKRLKKFLSXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXGTDAGRLNKAADEARKLAKAKGAEKAANVLLNLDKTLN
RLQQVQTTQGRINSAITQLTAEITKIKKNTVQAEKEAKDTENKLDSAKQQSVLEAGLSQL
RTTLQRNRGRAARLRAQAASAQRQAGGLEQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXLEKKTQDLNLSRQEKADQLKELEDQVVALKNEIVEREN
KYAACYR
Download sequence
Identical sequences 9685.ENSFCAP00000004135 ENSFCAP00000004135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]