SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000004742 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000004742
Domain Number 1 Region: 685-739
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000193
Family Laminin-type module 0.00037
Further Details:      
 
Domain Number 2 Region: 146-204
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000419
Family Laminin-type module 0.024
Further Details:      
 
Domain Number 3 Region: 741-789
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000391
Family Laminin-type module 0.0013
Further Details:      
 
Domain Number 4 Region: 202-260
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000226
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 5 Region: 792-833
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000586
Family Laminin-type module 0.009
Further Details:      
 
Domain Number 6 Region: 582-632
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000026
Family Laminin-type module 0.0093
Further Details:      
 
Domain Number 7 Region: 258-307
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000103
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 8 Region: 630-687
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000963
Family Laminin-type module 0.00039
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000004742
Domain Number - Region: 305-337
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00017
Family Laminin-type module 0.019
Further Details:      
 
Domain Number - Region: 840-885
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00159
Family Laminin-type module 0.031
Further Details:      
 
Domain Number - Region: 544-584
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00237
Family EGF-type module 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000004742   Gene: ENSFCAG00000005118   Transcript: ENSFCAT00000005119
Sequence length 1448
Comment pep:novel genescaffold:CAT:GeneScaffold_3482:1060514:1102304:1 gene:ENSFCAG00000005118 transcript:ENSFCAT00000005119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KAYEITYVRLKFHTSRPESFAIYKRTHAGSPWEPYQYYSASCQRTYGRPEGHYLRPGEDE
RVAFCTSEFSDISPLSGGNVAFSTLEGRPSAYNFEESPVLQEWVTSTELLISLDRLNTFG
DDIFKDPKVLQSYYYAVSDFSVGGRCQCHGHASECGPEEAGRLACRCQHNTTGVDCERCL
PFFQDRPWARGTAEAANECVPCNCSGHSEECVFDRDLFRGTGHGGRCLRCRDHTAGPHCE
RCQEDFYRWSPRTPCQPCDCHPAGSLRLQCDDSGTCACKATVTGWKCDRCLPGFHSLSEG
GCRPCTCNPAGSLGTCDPHSGRCPCKENVEGKQCDXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXAEGWRAGSVGGPEHPAQWSPRGLLLNPEGEEELTLPEK
FLGDQRSYGQPITLTFWVPRGGSPLPVRLRLEGAGLALTLRPSSLSGPQDAGQPGEAQLT
FQLQETSEDAAPPLPPFHFQQLLANLTALRIRAGGQSASPSGQVFLTEVRLTSAQRGLSP
PASWVETCSCPKGYTGQFCESCAPGYKRETPLGGPYTSCVPCTCNQHGTCDPHTGICLCG
HHTEGPSCERCLPGFYGSPFGGRADDCQPCPCPGQSACTAIPESREVVCTHCPPGQRGRR
CEICDDGYFGDPLGLSGAPQPCRRCQCSGNVDPNAVGNCDPQSGRCLRCLHNTTGAHCER
CEEGFYGSALAPRPADKCTPCSCYPGGSVSEQRPCDPASGQCTCLPHVTGRDCSQCSPGF
YDLRPGRGCRSCKCHPLGSQEDRCHPKTGQCPCRPGVEGQACNRCQLGFFGFSIKGCRAC
RCSPVGAASAQCHENGTCLCRPGFVGYKCEHCQENFFITAGGTHCQECPSCYALVKEEAS
KLKARLTLMEGWLQGSDCSEPWGPLHALQGEAPRGDVYQGRLLQGAREAFLEQVTGLEGA
VKAAREQLRTLSRSVHCARAGTEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXHRDTTAKIEATARRALVASNTSYALLWSLVEGRVALEAQQE
LEDRYQEVQAAQKALGTAAAEVLPEAGRALAAAQQADADAALRPASLAAPAALQKSEAGA
LGLKAQALEKTVASREHVVTEAAGVLQATAQAMLRKTEPLTQLRQQARAALTRASSSVQA
ATVTVTGARTLLADLEGMKQQFPSPKDRATLGRKAGVVRGRLLPDLKKKTKQAERMLGNA
ASVSSSAKKKGREAKTLAEDSAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLDTHQAPARALNE
TQWALERLRLRLSPPGALQGKLRLLEQESKQQELQIQSFENDLAEIRADKRNLEAILQSL
PKSCASWR
Download sequence
Identical sequences ENSFCAP00000004742 9685.ENSFCAP00000004742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]