SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000005098 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000005098
Domain Number 1 Region: 51-139
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.71e-34
Family SCAN domain 0.00014
Further Details:      
 
Domain Number 2 Region: 222-282
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.85e-24
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 3 Region: 488-545
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.44e-21
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 4 Region: 753-804
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.03e-19
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 5 Region: 671-721
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.06e-17
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 6 Region: 827-878
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.75e-16
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 7 Region: 968-1020
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000278
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 8 Region: 590-642
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000998
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 9 Region: 869-919
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000142
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 10 Region: 530-582
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000512
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 11 Region: 439-489
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000232
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000005098   Gene: ENSFCAG00000005494   Transcript: ENSFCAT00000005497
Sequence length 1023
Comment pep:novel scaffold:CAT:scaffold_167814:6186:14139:-1 gene:ENSFCAG00000005494 transcript:ENSFCAT00000005497 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPGRWYAVHPAQARASREQVRLQMVKKEEEDEGYTSAQAARPQTLNRSGQELFRQLFRQ
LRYHESSGPLETLSRLRELCRWWLRPDILSKAQILELLVLEQFLSILPGELRTWVQLHHP
ESGGEAVALLEELQRDVDGTPWRDPALAQSPDVRWMGTGTLRASQIWPPASPLRSSSTLG
DHLEPPYEIGVCDFLAGQSEPPVAQAPALSQREGCPGDLLTAQPQEAVTFKDVEVIFSQD
EWGWLDPAQRNLYRDVMLENYGNMVSLGGPFTKPVLISWMEAREPWGLNVQGAQPKGNPG
VALAGGELQIKTNKFVLKHEPLEEAETFAVPSECCVMSVSEGIRLRESLEKKGRLKQQCG
SPIQSRVKKEETKFSHRTAKESEESGRSASLNLKHATYLRVPRRKRSLKHGCGRHFRGGS
YHCDYKEYGKGLRRMFGGFSLHQRIHAGLKGNAKDVHGKDFRLSPHHQRGQNLHMVETSY
KCSDCGRAFSHSSHLACHQRLHTQEKPFKCRVCGKAFRWSSNCVRHEKIHTGVKPYKCSL
CDKAFRRLSAYRQHQETHAKQKSLESHQYEEALTCGSGFDNHLRDQSRGKLFDCSQCRKS
FHCKSYVVEHQRVHTQEKPYKCTKCRKTFRWRSNFTRHMRMHQEEKFYDQDKCKDFRLAS
SCGQLQGAPAREKAFPCQQCGKTFTRKKSLIDHQRIHTGEKPYRCSECEKEFTHRSAFIA
HKKQHAIQRRPENGPSSSQDTVLQLPPNSTEEAYKCSQCGKAFRNHSFLLIHQRIHTREK
PYKCRECGKAFRWSSNLSRHQRIHSLEKRYECHESENTPNLQPQILTGEKPFWCQECGKT
FTRKRSLVDHKGIHSGEKRYKCNLCGKSYDRKHRLVNHQRIHTKERPFKCQWCGKDFIGR
HTLRIHQRKHTRVAQSECSLAALSSCQDTGVSLQELKPSGEKPLEDSEEACDQSSRLTGV
QNIPIGKKCHKCSTCGKTFNKSSQLISHKRFHTRERPFKCRECGNTFRWSSNLARHMKNH
IRD
Download sequence
Identical sequences 9685.ENSFCAP00000005098 ENSFCAP00000005098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]