SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000005136 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000005136
Domain Number 1 Region: 712-787,818-906
Classification Level Classification E-value
Superfamily RUN domain-like 1.22e-35
Family RUN domain 0.0014
Further Details:      
 
Domain Number 2 Region: 1193-1246
Classification Level Classification E-value
Superfamily RUN domain-like 0.0000824
Family RUN domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000005136   Gene: ENSFCAG00000005536   Transcript: ENSFCAT00000005539
Sequence length 1252
Comment pep:novel genescaffold:CAT:GeneScaffold_3782:134665:281921:-1 gene:ENSFCAG00000005536 transcript:ENSFCAT00000005539 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LYQWLEADRHGKSQDAANTTSGENFDQSPLRRTFKSKVLAHYPENIEWNPFDQDAVNMLC
MPKGLSFRTQTDNKDPQFHSFIITREDGSRTYGFVLTFYEEVTSKQICTAMQTLYQMHNA
EHYSSVYASSSCSMDSLASSTDEGDTTSLLKLQRYNSYDISRDTLYVSKSICLITPLPFM
QACKKFLIQLYKAVTSQQPPPLPLESYIHNILYEVPLPPPGRSLKFYGVYEPVICQRPGP
NELPLSDYPLREAFELLGLENLVQVFTCVLLEMQILLYSQXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXANLCFVDIDNHFIELPE
EFPQFPNKVDFIQELSEVLLQFGIPPEGSLHCSESATKLKNLVLKDLVNDKKNGNVSTHN
ISMYELLKGNETIARLQALAKRTGVTVEKMDLSASLSEKEKDLKLQCEEAELRDYQLNVQ
LREVFANRFTQMFADYEAFVIQTAQDMESWLTNREQMQNFDKASFLSDQPEPYLPFLSRF
IETQMFATFIDNKIMSQWEEKDSLLRVFDSRIEKIRLYNVRAPTLRTSIYQKCSTLKEAA
QSIEQRLMKMDHTAIHPHLLDMKIGQGKYEQGFFPKLQSDVLATGPTNNXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXKYMQEARSLGKNLRQPKSDLSPAVIAQTNCKFVEGLLKE
CRMKTKRMLVEKMGHEAVELGHGEANITGLEENTLIASLCDLLERIWSHGLQIKQGKSAL
WSHLIQFQDREEKQEHLAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHIQNMSEIKTD
VGRARAWIRLSLEKKLLSQHLKQLLSNQLLTKKLYKRYAFLRCEEEREQFLYHLLSLNAV
DYFCFTSVFTTIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFPCGRWLGKGIDDGSLERI
LIGELMTSVADEDLVKQCRTPPQQKSPTSARRLSITSLTGKTTKPNAGQIQEGIGEAVNN
IVKHFHKPEKERGSLTVLLCGENGLVVALEQXXXXXXXXXXXXXXXXXXXXXXXKAVAYF
ETTDQILDNEDDVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDRLLPQWI
PLLAECPAITRMYEESALLRDRMTVNSLIRILQTIQDFTIVLEGSLIKGVDV
Download sequence
Identical sequences ENSFCAP00000005136 9685.ENSFCAP00000005136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]