SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000005246 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000005246
Domain Number 1 Region: 155-187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000434
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000005246
Domain Number - Region: 459-750
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00065
Family Rhodopsin-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000005246   Gene: ENSFCAG00000005648   Transcript: ENSFCAT00000005652
Sequence length 763
Comment pep:novel genescaffold:CAT:GeneScaffold_1778:113:10902:-1 gene:ENSFCAG00000005648 transcript:ENSFCAT00000005652 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLTQLLLPLGAAAQKTSDCARWCPLNSRCVNATACRCSPGFTSSSGDVFTNRLENCDXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVDECSSGKHQCHNTTHCINVKGSYKC
YCHHDWVARSRPLHGLNFTICEDVHFPSWTSPSGVNSQSLSRFFDKVXXXXXDKPALAKN
TIQDLMQEVDELLETPGDLETLAPSEQHCVATHLLVGLEDVLRVLSKLLPNGPLTAHAPA
GTDLSLKVQEQGDRNVTLSLNQAKMLLSLDEVHESSDSGPSVVGLVSTPGMAKFLAEAPL
VLDHKQQAVLREHKELLGEVPPVLLSGVVSAFVSNKDTQNLGSPVTFIFSHHSVTPGPTQ
KVFCVFWEHSQDGGGHWSTTGCRMAATGDASTTCQCSHLSSFAVLMAHGHVQEEDPVLAV
ITYVGLGLSLLCLLLAALTFLLCKAIQNTSTSLHLQLSICLFLAHLLFLTAIDQTKIKLL
CAIIAGALHYLYLASFTWMLLEGLHLFLTARNLMVVNYSSMSRFTKRLMFPVGYGVPALI
VAVSAASRPSLYGTPTRCWLHTEKGFVWTFLGPVCTIFSINLAFFLMTFWIVRNKLSSLN
RDVSTLQNTRMLTFKATAQLLILGCTWCLGLLQVGPAARVMAYLFTIINSLQGMFIFLVY
CLLSQQVREQYGKWFRGVRKAKAEPENYTLSSRTVSDASQHSA
Download sequence
Identical sequences ENSFCAP00000005246 9685.ENSFCAP00000005246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]