SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000005585 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000005585
Domain Number 1 Region: 347-404
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.79e-25
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 431-488
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.05e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 263-320
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.03e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 4 Region: 7-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.62e-21
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 5 Region: 473-525
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2e-17
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 6 Region: 197-255
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.29e-16
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 7 Region: 310-342
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000161
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 8 Region: 394-426
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000112
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000005585   Gene: ENSFCAG00000006010   Transcript: ENSFCAT00000006012
Sequence length 525
Comment pep:novel genescaffold:CAT:GeneScaffold_2958:7542:16948:-1 gene:ENSFCAG00000006010 transcript:ENSFCAT00000006012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPALALVSFEDVAVTFTGEEWRQLDLAQRTLYQEVMLETCGLLVSLGHPVPKPELIYP
LEPGQELWTGKRGVSKSTCTGEKAKPETTEFTASQLAFTEEAPFEEQMTQGASRDSRLGQ
ARDREKLSEMQEGNLRPGTDPHEETCPRKLSHKHDDLETDDSLCLTILQERVTIQDDLHE
HDCQGPRKDPVTDARNNLYKCKECGKGFSKNWALVRHQQIHAGVKPYKCSECGKACRYMA
DFIRHTRFHTGEKPYKCVECGKAFKRRSHLTEHQRIHTGDKPYECKECGKAFTHRSSFIQ
HNMTHTREKPFLCKECGKAFYYSSSFAQHMRIHTGEKPYACSECGKAFTHRSTFVRHKRT
HTGEKPFQCKECGKAFCDSSSLIQHMRIHTGERPYECSECGKAFTHHSVFIRHNRTHTGE
KPLECKQCAKAFYYSSSFTRHMRIHTGEKPYVCRECGKAFTQPANFVRHNRIHTGEKPYE
CKDCKKAFCDNFALTQHTRTHTGEKPFECGVCGKTFSHSSSFTHH
Download sequence
Identical sequences 9685.ENSFCAP00000005585 ENSFCAP00000005585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]