SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000005733 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000005733
Domain Number 1 Region: 288-345
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.39e-26
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 373-429
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.57e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 28-88
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.15e-24
Family KRAB domain (Kruppel-associated box) 0.00093
Further Details:      
 
Domain Number 4 Region: 204-261
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.48e-23
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 5 Region: 414-466
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.64e-20
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 6 Region: 335-367
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000108
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 7 Region: 251-283
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000381
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 8 Region: 127-173
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000651
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000005733   Gene: ENSFCAG00000006170   Transcript: ENSFCAT00000006171
Sequence length 477
Comment pep:novel genescaffold:CAT:GeneScaffold_4005:2618:46383:-1 gene:ENSFCAG00000006170 transcript:ENSFCAT00000006171 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLRQDKVSDFCSGFIVSILSQEQQKMNKYQGPVTFKDVIVEFTREEWQLLDAAQRTLYKE
VMRENYGHLVSVGYCVNKPNAVFKLKQGKEPWILEVEFPRRNYPEDLWKIHDLGARSQGS
QAENSRNGELTKHQQTPAREKIYKCSECAKSFCQKSILLIHQHTHSKDKPREYGTSVPRN
GDLARQQKGQAREKTYECKECTKTFYHLSSLSRHLRTHAGEKPYECNQCEKSFYQKPHLV
EHQKTHTGEKPYECNECGKFFYVKAYLMVHQKTHTGEKPYECKECRKSFSQKSHLTVHQR
THTGEKPYKCKECGKFFSRNSHLKTHQRTHTGEKPYECKECGKCFYQKSALTVHQRTHTG
EKPFECNKCGKNFYYKSDLTKHQRKHTGEKPYECQECGKSFSVNSVLRLHQRTHTGEKPY
ECKECGKSFSQKSHFIIHQRKHTGEKPYECQECRKTFIQKSKLTAHQKTHRKKAYKQ
Download sequence
Identical sequences 9685.ENSFCAP00000005733 ENSFCAP00000005733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]