SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000006018 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000006018
Domain Number 1 Region: 382-439
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.94e-26
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 2 Region: 438-495
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.32e-26
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 3 Region: 548-605
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.72e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 495-549
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.26e-24
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 5 Region: 604-661
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.78e-23
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 6 Region: 9-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.31e-22
Family KRAB domain (Kruppel-associated box) 0.002
Further Details:      
 
Domain Number 7 Region: 344-396
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.35e-19
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 8 Region: 646-698
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.29e-19
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000006018
Domain Number - Region: 251-304
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00012
Family Classic zinc finger, C2H2 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000006018   Gene: ENSFCAG00000006475   Transcript: ENSFCAT00000006477
Sequence length 699
Comment pep:novel scaffold:CAT:scaffold_155978:33055:40457:1 gene:ENSFCAG00000006475 transcript:ENSFCAT00000006477 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAHSQPVPSQPPVSFKDVAVTFTREEWGQLDPAQRTLYRNVTLETCSHLAFLGLLLSKP
AVICWLEQGQDPWRAEHGPPRDWKNTLGKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXVTLGGRQDWRDQLREHQEDPLSQTILTPERPFAHGKHYEPDLGGSYLNLRLLPPTLP
TRAHFHTLESQVKKLKQNSVFINHEKGWADLKPHENYQSPSAFYQSISLNKFTNVETRNK
KPYEYTVSSDSFNYDTSLRYHNRIFSAESSDDCTDYRNIINHSMSMNEHKPMHFRELQYE
CDKCLVQTVISDPEEAPFRCEEECNTFHEASSFTDCDIIQTGKKPHACNQCGKSFSCCSK
LVVHQRTHTGEKPYECSLCGKSFSQSYDLVVHQRTHTGEKPYECNQCGKSFTQSSKLIRH
QRTHTGEKPYKCHECGKSFRWNSNLIVHQRIHTGEKPYECGHCGKSFSQSSDFVAHKRTH
TGEKPYECNQCGKSFKHQLIRHLRIHTGEKPYKCNQCDKAFTGSSHLIEHQRTHTGEKPF
ECNQCGKAFAGSSHLLSHQRIHSGEKPYECNDCGKSFRQRSQLVVHQRTHTGEKPYECSH
CGKAFSQRSPLIVHQRTHIGDKPYQCNMCFKAFSQKSRLIEHQRTHTGEKPYECIDCGKA
FNDRSTLTKHERTHTGEKPYECNHCEKAFSQRCQLTRHQ
Download sequence
Identical sequences 9685.ENSFCAP00000006018 ENSFCAP00000006018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]