SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000006097 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000006097
Domain Number 1 Region: 30-166
Classification Level Classification E-value
Superfamily Cupredoxins 2.19e-48
Family Ephrin ectodomain 0.00000427
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000006097   Gene: ENSFCAG00000006562   Transcript: ENSFCAT00000006564
Sequence length 232
Comment pep:novel scaffold:CAT:scaffold_203378:23927:36139:1 gene:ENSFCAG00000006562 transcript:ENSFCAT00000006564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARPGQRWLGKWLVAMVVLALCRLATPLAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKL
DIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPN
YMGLEFKKHHDYYITSTSNGSLEGLENREGGVCRTRTMKIVMKVGQDPNAVTPEQLTTSR
PSKEADNTIKMATQAPSGRGSLGDSDGKHETVNQEEKSGPGASGGGSGDPDS
Download sequence
Identical sequences 9685.ENSFCAP00000006097 ENSFCAP00000006097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]