SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000006221 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000006221
Domain Number 1 Region: 158-206
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000533
Family EGF-type module 0.017
Further Details:      
 
Domain Number 2 Region: 103-250
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000408
Family Growth factor receptor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000006221   Gene: ENSFCAG00000006693   Transcript: ENSFCAT00000006694
Sequence length 525
Comment pep:novel genescaffold:CAT:GeneScaffold_2285:95198:186594:1 gene:ENSFCAG00000006693 transcript:ENSFCAT00000006694 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDPCSAYISLNEPWRNTDHQFDESQGAPLCDNHVDGEWYRFTGMAGDAMPTFCIPENHCG
THAPVWLNGSHPLEGDGIVQRQACASFSGNCCLWNTTVEVKACPGGYYVYRLTKPSVCFH
AYCGHFYDICDEDCHGSCLDTSECTCSPGTVLGPDRQTCFDENECEQNNGGCSEICVNLK
NSYRCDCGVGRVLRSDGKTCEDIEGCHNNNGGCSHLCLVSEKGYQCECPRGLVLSEDNHT
CQVPVLCRSNTIEVSIPRDLVGGLELFLTNTSCRGVSNGTHVNILFSLKTCGTVVNXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGKGHKEVFLHCQVLVCG
RLDEHSRCAQGCHRRMRREAVEGEDTAGLQSQMLTGGPISIDWED
Download sequence
Identical sequences 9685.ENSFCAP00000006221 ENSFCAP00000006221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]