SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000006604 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000006604
Domain Number 1 Region: 328-385
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.47e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 2 Region: 216-273
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.77e-24
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 3 Region: 384-441
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.24e-23
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 4 Region: 272-329
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.79e-23
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 5 Region: 2-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.35e-22
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 6 Region: 164-217
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.91e-22
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 7 Region: 109-162
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.89e-21
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 8 Region: 430-482
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.81e-19
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000006604   Gene: ENSFCAG00000007120   Transcript: ENSFCAT00000007122
Sequence length 489
Comment pep:novel scaffold:CAT:scaffold_198315:68029:71321:-1 gene:ENSFCAG00000007120 transcript:ENSFCAT00000007122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESVTYKDVAVDFTQEEWALMDTSQRTLYRDVTLENISHLVSVGCHFFRSDVISQWEQRGE
LCMKNSHNKQEIIPMQDICMNDPPNCWTVKCHTGEDLSVYSGFDEVFTQRTLTQHVITHT
GENPFACNQCGRRFRYFSSLTRHKRIHTGEKPYECRLCGKAFVRSSIKRHERTHTGEKPF
KCHLCGKGFVTRSNLREHERTHTGEKPYTCHQCGKAFVTSSNLREHERTHSGEKPYKCHL
CGKAFVQSSCLRDHERIHTGEKPYKCPICGRAFVTSSCLRKHERTHTGERPYACHLCGKA
FIQSSNLRDHERTHTGEKPYTCHLCGKAFVTSSNLREHERTHSGEKPYKCHLCGKAFVQS
SYLRDHERTHTGEKPYKCHLCGKAFVTSSCLRKHERTHTGEKPYTCHLCGKSFVQSSNLR
EHERTHTGEKPYKCHLCGKAFVTSSNLRKHEKTHTGEKPYTCHLCGKAFVQSSYLREHER
IHTRETIYM
Download sequence
Identical sequences ENSFCAP00000006604 9685.ENSFCAP00000006604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]