SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000006761 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000006761
Domain Number 1 Region: 977-1128
Classification Level Classification E-value
Superfamily FAS1 domain 7.72e-28
Family FAS1 domain 0.0016
Further Details:      
 
Domain Number 2 Region: 338-504
Classification Level Classification E-value
Superfamily FAS1 domain 3.14e-20
Family FAS1 domain 0.0027
Further Details:      
 
Domain Number 3 Region: 520-577,615-655
Classification Level Classification E-value
Superfamily FAS1 domain 0.000000000149
Family FAS1 domain 0.0064
Further Details:      
 
Domain Number 4 Region: 1135-1186
Classification Level Classification E-value
Superfamily FAS1 domain 0.0000000602
Family FAS1 domain 0.0099
Further Details:      
 
Domain Number 5 Region: 234-289
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000293
Family EGF-type module 0.037
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000006761
Domain Number - Region: 2084-2120
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000147
Family EGF-type module 0.071
Further Details:      
 
Domain Number - Region: 877-915
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00115
Family EGF-type module 0.062
Further Details:      
 
Domain Number - Region: 1436-1468
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00461
Family EGF-like domain of nidogen-1 0.075
Further Details:      
 
Domain Number - Region: 910-964
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00698
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 1965-1998
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00795
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 1823-1880
Classification Level Classification E-value
Superfamily FAS1 domain 0.0641
Family FAS1 domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000006761   Gene: ENSFCAG00000007290   Transcript: ENSFCAT00000007294
Sequence length 2134
Comment pep:novel genescaffold:CAT:GeneScaffold_2150:393:276322:1 gene:ENSFCAG00000007290 transcript:ENSFCAT00000007294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMLQKFMLFLLGLVVQNFCSPPETTEQAKRCDKTSLLTIRTECRSCLLNLEIKCPDGYTK
VTNGSVGVRDCRYTFEIRKYSLSLPGCRHICRKDYVQPQCCPGHWGPDCMECPGGARSPC
NGRGSCAEGMEGNGSCSCQDGFGGAACETCTDDNVFGPSCSAXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGDGQYCEPINP
CLKEICHPHALCTYEGPNRHSCTCQEGYHGDGRVCLPVDPCQTNYGNCSAKSTVCIYDGP
GQSHCECKKHYRDYVPGVGCSVIDVCKLNNPCHRNANCTTIAPGQTKCTCRKGYVGDGST
CYGNIMERLRELNTEPRGKWQGRLTSFISLLDKAYAWPLSNLGPFTVLLPTDKGLRGFSV
KELLMDKESAQYFVKLHVIAGQMNTESMNNTDTFYTLTGKSGEIFNDDKDNQIKLKLYGG
KKKAKIIQGNIVASNGLLHILDRAMDKMAPTFESNAEKTIMTMLQPRYSKFRSLLEETNV
GHALDEDGAGGPYTVFVPSNEALVNMKDGTLDYLLSPEXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXGQILANGVAMEDTEVNAKNGRIYTLTGVLVPPSIVPI
LPHRCDETKREMKLGTCVSCSLVYWSKCPANSERTXXXXXXXVYTGRRSLKSGCARYCNA
TVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCADGLDGNGTCICQDGFQGSQCQFCSDP
NKYGPRCDKKCLCIYGTCNNRIDSDGACLAGTCREGSTGTFCHKQTSTCGPYVQSCHIHA
TCEYSNGTASCVCKAGYEGDGSLCSETDPCTGFTPGGCSHNAECIKTGPGTHTCVCQQGW
TGDGRDCSEINNCLLPGTGGCHVNATCLYVGPGQNECECKEGFRGNGIDCEEITSCLEQT
GKCHPLATCQFTSSGVWSCVCQEGYDGDGLLCYGNAAVELSFLSAAAIFNQWINNASLQA
MLSATSNLTVLVPSPQAIENMDQDEKAFWLSKSNIPALIKYHVLLGTYRVADLWALSPSD
MLATSLQGNFLHLAKADGNITIEGASVIDSDNAATNGVIHIINKVLVPRRSLTGSLPNLL
TRLDQMPNYSIFRGYIIQYNLASAIEAADAYTVFAPNNDAIENYIREKKIATLXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLYVNEAPINYTNAATDKGVIHGL
GKVLEIQKNRCDNNDTTIVQGKCGKCSQQPICPPGTKPLGEETRRCIYTFYFMGKRSVFI
GCQPNCMKTVITRECCAGFFGPQCQPCPGKAEVCFGNGICXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXITKDDCNGVCHT
SANCLLNPDGTASCRCAAGFQGNGTVCTAINACETSNGGCSAKADCKXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXILAVDLPRSAAWTTLQGSELGVKCGTGRDVGELFLNDQACRI
VQRELLFDLGVAYGIDCLLIDPTLGGHCDTFAAYNFSGDCWSCDNTPSCPRWSKSKGVKQ
KCRYYLSLRGYVEGCREQCVMVVRLPRCCKGYFGRDCQACPGGADAPCNNRGVCLDQYSG
LGECKCHTGFNGTACELCLPGRFGPDCQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXLPPVCTPPCSADATCKENNTCECNLSYEGDGITCTVVDFCKQNNGGCAKVAKCSQK
GTRVSCSCQKGYKGDGRSCIEIDPCADGVTGGCH
Download sequence
Identical sequences 9685.ENSFCAP00000006761 ENSFCAP00000006761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]