SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000007327 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000007327
Domain Number 1 Region: 18-187
Classification Level Classification E-value
Superfamily RUN domain-like 2.62e-40
Family RUN domain 0.0009
Further Details:      
 
Domain Number 2 Region: 530-643
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000221
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 3 Region: 686-787
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000918
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000007327   Gene: ENSFCAG00000007911   Transcript: ENSFCAT00000007913
Sequence length 1022
Comment pep:novel scaffold:CAT:scaffold_3739:36946:77733:-1 gene:ENSFCAG00000007911 transcript:ENSFCAT00000007913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSVVENGLDPRAAIPVIKKKLVGSVKALQKQYVSSDTVVTSEDGDANTMCSALEAVFIH
GLHAKHIRAEAGGKRKKSAHQKPLPQPVFWPLLKAVTHKHIVSELEHLIFVSTDVGRCRA
WLRLALNDGLMECYLKLLLQEPARLCEYYQPTALLRDAEEGEFLLSFLQGLTSLSFELSY
KSAILNEWTLTPLALSGLCPLSELDPLATSGTELQRKESLDSISHSSGSEDIEVQHSGHK
IRRNRKLTASSLSLDTASSSQLSCSLNSDSCLLQENGSKSPDRSEEPMSYDSDLGTANAD
DSDPSLQEVLSEFSKAQVNSVPTNGLSGLSGEMEIPTGRASLPLPGLEASIPFDVPAEPL
PPQASSGTQDGDRKQEPPPQASGTLGLLQPSVSILDQRPSSPVREAAARAVSPGSGQQKS
LEDDGAARSLGVSSPTSPKSRSWISEDDFYRPPQEPPAESPSEHSVASSGGTPESRPGLL
RHFSQGPRKSHSTGALDQACVPSPGGRPSRAAAAQEHQNFRVVHRRQMGLSNPFRGLMKL
GTVERRGAMGIWKELFCELSPLEFRLYLNTEERTCVENCSLLRCEAVGPAHGDGRFELVF
SGRKLALRASSQDEAEDWLDRVREALQKCRPQQEDEWVNIQYPEQPEDPPDAPQGGLPSH
PDPPTEPETLQGTQFCWSSAQVPEPDAIKESLLYLYTDRTWMPYIFSLSLESLKCFRVRN
NEKMLSDSHGVETIRDILPDTSLGGPSFFKIITAKAVLKLQAGNAEEAALWRELVRKVLA
SYLETAEEAVTLGGSLDENCQEVLKFATRENGFLLRYLVAIPTEKGLDSQGCFCAGCSRQ
IGFSFVRPKLCAFSGLYYCDICHQDDASVIPARIIHNWDLTKHPICRQALKFLTQIRAQP
LINLQLVNASLYEHVEQMRLVRRRREQLKLLGDYLGLCRSGALKELSKRLNHRNYLLESP
HKYSVADLQQIADGAYEGFLDALIGFASQHVYHCDLCTQRGFICQICHHHDIIFPFEFDT
TV
Download sequence
Identical sequences ENSFCAP00000007327 9685.ENSFCAP00000007327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]