SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000007385 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000007385
Domain Number 1 Region: 835-892
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.59e-25
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 2 Region: 451-508
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.82e-23
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 3 Region: 779-836
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.71e-21
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 4 Region: 666-723
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.08e-19
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 5 Region: 493-545
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.28e-18
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 6 Region: 628-680
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000281
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 70-121
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000000235
Family KRAB domain (Kruppel-associated box) 0.0028
Further Details:      
 
Domain Number 8 Region: 722-780
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000462
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 9 Region: 877-927
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000139
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 10 Region: 272-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000128
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 11 Region: 549-601
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000927
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 12 Region: 397-452
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000286
Family Classic zinc finger, C2H2 0.03
Further Details:      
 
Domain Number 13 Region: 314-361
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000128
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000007385   Gene: ENSFCAG00000007971   Transcript: ENSFCAT00000007972
Sequence length 934
Comment pep:novel genescaffold:CAT:GeneScaffold_954:74663:87892:1 gene:ENSFCAG00000007971 transcript:ENSFCAT00000007972 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RDGRQSGRLPSLILLLPDILGAHRHGQGASPRRKGDFLPAPLCLLRLCQPGTWRGRRGIL
SEATESQSATTKEFVTHRDVAMDFTLEDWEQLGLDQGDLFWDTALDNYQNLFLLNPCKPK
LTSCPDGGEELEAVVRESPESGGLDMAEVKNCPLAQDFLEEGLSQEIMETLSKDGLGNSS
LGKAYVGESWLDSLLGDPESLLKSDVVTNKGSPTECRSRELQRDLGPEPLLSVREDSVMR
DLPEKSPAKSQERGKDFGCDLDQSQQDPVQGGEKLYKCSECGESFSQSYHLIQHWIVHTK
EKPAVHEEYEEGCSQRSCLFVPLTTHTDYKSCARNEGGKTCTQSTHLLWHQKIHTGEEPH
KNQDGDPPSGLSLQPAEQQKPYTGDESYKGNKPGEGFSPTSHLTQHQKTHTQKRYECAKC
KATFNFSKYLLQHEKTHATKTTSEHQECGKAFGQSTLLAEHQSIHTGEKPYECDQCGRPF
RNISTLKVHQRVHSGEKPYKCNECGKSFYRSTHLNEHQRIHTGYRPYKCHQCIKSFSRPS
HLIRHQSVHATGKSYCCARCKKTFSHNEYLVQHQKMHAMETLHECQECGERFFCSSTLAC
HQSVHAREKQALGESGSILSQDSEWREKHFKCSKCEKTFSCSKYLTQHERVHTRVKPFEC
DQCGKAFSKSTQLLRHQNIHSRVRPYECGDCGKAFIRSTSLTKHQATHKSEHPFTCNECG
KTFSQSAHLSEHQLTHTEEKKLCKYSKCDKALAQGNCLTQHQRTDAGKKSFECDERDKSF
HLSSCLSKHQRDHTGEKPHKCSDCEKTFSLGAQLLHHQRVHTGEKPYVCQECGKAFSQSS
CLSVHRRIHTGEKPYVCAECGKAFSQKANLMQHERVHTGEKPYACRVCGKAFGLSAHLSQ
HQRVHTQEKQCQYCQKALGLSRHQQVHNKQYYKV
Download sequence
Identical sequences ENSFCAP00000007385 9685.ENSFCAP00000007385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]