SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000007495 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000007495
Domain Number 1 Region: 54-123
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.78e-16
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 2 Region: 212-256
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000046
Family EGF-type module 0.013
Further Details:      
 
Domain Number 3 Region: 111-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000201
Family EGF-type module 0.0069
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000007495
Domain Number - Region: 248-279
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00135
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000007495   Gene: ENSFCAG00000008087   Transcript: ENSFCAT00000008089
Sequence length 414
Comment pep:novel genescaffold:CAT:GeneScaffold_2940:478941:516869:1 gene:ENSFCAG00000008087 transcript:ENSFCAT00000008089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NCLNKQQLLTAIRQLQQVLKGQETRFAEGIRNMKNRLAALQNSVNRVGPDTPPVSCPALN
APLDGRKFGSKYLVDHEVHFTCNPGFRLVGPSSVVCLPNGTWTGEQPHCRDMRECSSQPC
QNGGTCVEGISQYKCICPPGKTGSHCQHQAQTXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXVNECELYGQEGRPRLCMHTCVNTPGSYRCACPSGYRTMADG
KSCEDVDECVSPQHVCPRGTMCINTGGGFQCVSPECPEGSGNVSYVKTSPXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMATASAPGRPGPNSLRFGIVGGNSRGHFV
MQRSDRQTGELILVQTLEGPQTLEVDVDMSEYLDRSFQANHVSKVTIFVSPYDF
Download sequence
Identical sequences ENSFCAP00000007495 9685.ENSFCAP00000007495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]