SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000007547 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000007547
Domain Number 1 Region: 1454-1631
Classification Level Classification E-value
Superfamily Cupredoxins 1.51e-47
Family Multidomain cupredoxins 0.0000297
Further Details:      
 
Domain Number 2 Region: 326-509
Classification Level Classification E-value
Superfamily Cupredoxins 6.19e-46
Family Multidomain cupredoxins 0.0000401
Further Details:      
 
Domain Number 3 Region: 13-178
Classification Level Classification E-value
Superfamily Cupredoxins 4.96e-38
Family Multidomain cupredoxins 0.00000013
Further Details:      
 
Domain Number 4 Region: 516-644
Classification Level Classification E-value
Superfamily Cupredoxins 1.98e-33
Family Multidomain cupredoxins 0.00024
Further Details:      
 
Domain Number 5 Region: 1782-1938
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.79e-32
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00000145
Further Details:      
 
Domain Number 6 Region: 183-305
Classification Level Classification E-value
Superfamily Cupredoxins 4.66e-31
Family Multidomain cupredoxins 0.00000127
Further Details:      
 
Domain Number 7 Region: 1641-1739
Classification Level Classification E-value
Superfamily Cupredoxins 6.02e-22
Family Multidomain cupredoxins 0.00000822
Further Details:      
 
Domain Number 8 Region: 1939-1988
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000000017
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000755
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000007547   Gene: ENSFCAG00000008147   Transcript: ENSFCAT00000008149
Sequence length 1989
Comment pep:novel genescaffold:CAT:GeneScaffold_4810:72582:199276:-1 gene:ENSFCAG00000008147 transcript:ENSFCAT00000008149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GWAPARAARQFYVAQGIRWDYRPEPADPSSNPFATSFQKIVYREYEPYFQKEKPRSKISG
LLGPTLYAEVGDIMKVHFKNKADKPLSIHPQGIKYSKFSEGASYSDHTFPVEKLDDAIAP
GQEYTYVWNISEDSGPTHNDPPCLTHTYYSYENLVQDFNSGLIGPLLICKKGTLTEDGIQ
KMFDKQHVLMFAVFDESKSWSQSSSLMYTVNGYVNGTMPDITVCAHDHISWHLIGMSSGP
ELFSIHFNGQVLEQNHHKISAITLVSSTSTTANMTVGPKGKWIISSLFPSHFQAGMQAYI
DIASCAKKTRNPKKLTRDQRRHIKRWEYFIAAEEVIWDYAPIIPANMDKKYRSLHLDNFS
NQIGKHYKKVVYKQYQDESFTKRMENPNIKEDGILGPIIRAQVRDTLKIVFKNMASRVYS
IYPHGVTFSPYEDEVNSSFTSGNNTMIRAVQPGETYTYKWNILESDEPTENDAQCLTRPY
YSNVDITRDIASGLIGLLLICKSRSLDKRGIQRAADIEQQAVFAVFDENKSWYIEDNINK
FCENPDKVKRDDPKFYESNVMSNFTLSAINGYVPESIPTLGFCFDDTVQWHFCSVGTQDD
ILTIHFTGHSFVYGKRHEDTLTLFPMRGESVTVTMDNVGTWILTTVNSSPRSKNLRLRFR
DVKCIRDEDEDSYEIIYEPLASTAMTTRKMRDSSENRGEEDDADYDYQENLASWLGIRSF
RNSSLNQEEEEFNLTALALENYSEFIPSSTDPAIRSNSSFLSSISRLIVHNFAGPHKTLP
RPEATTAGPPLGRIGLDKKSVLNSSKEEHSSPYSEDSMEDPLPSDITGISLLPLDADGFX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXADRRLNHSLLFHKSKETLFPTDFNQTFPSVNLSMIASLP
NHNQNPPNDTSQTSSPSDLYQTITPEERYQTFSIQDSDQMHSTTESSHGSLPEPGQMLNY
DLRNKSFPTDIAQMFPSLEPEAWQTTISADLSQPTLSPDLSQTAVTPDLGQMPLSPDLSQ
EPLLSDLSQMALSPDHRQTTLSPDLSQTDVSPDLSEITISPDLIKMNLPPDLSQMPFFPD
LSQETLSSDLSQMPLSPDLGQETLSSDVGRTTLSPDTSQTTLSQDLGQIPLSPDISQTAL
SPDLRQTSSPPDLDQTSNTSEFSHSLLLPEFGQTSPSPDLSQVPSPPLSSTVNNTFIPRE
LNPPVVIGLSGNDGDYIEIIPRQKEESSEEIIDDIDYVAYDDPYQTDVRTDINSSRNPDN
IAAWYLRSNNGNKKYYYIAAEELSWDYSKFAQSEVDNEDIDDVPENTVYKKVVFRKYLDG
SFTKRDPTGELEAHLGILGPVIRAEVDDVIQVRFKNLASRPYSLHAHGLSYEKSSEGKSY
EDDSPEWFKEDNVVQPNSSYTYVWHATPRSGPENPGSACRAWAYYSAVNPEKDIHSGLIG
PLLICQKGVLHKESNTPVDMREFVLLFMVFDERKSWYYEKKPQSPRAWRLSSSEEKTSHE
FHAINGMIYSLPGLRMYEQEWVRLHLLNMGGSRDIHVVHFHGQTLLENGTQQHQLGVWPL
LPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCKMPMGLSTGIIADSQIR
ASGHWGWEPKLARLNNGGSYNAWITEKPSEVDLKPWIQVDMQREVVLTGIQTQGAKHYLK
SYYTMEFYVAYSSDQTNWQIFKGNSTRNVMXXXXXXXXXXXXXXXXXXXXXXXXXRISPT
RSYNRAALRLELQGCEVNGCSTPLGMESGKIENKQITASSFKKSWWGDYWEPFRARLNAQ
GRVNAWQAK
Download sequence
Identical sequences 9685.ENSFCAP00000007547 ENSFCAP00000007547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]