SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000007549 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000007549
Domain Number 1 Region: 51-168
Classification Level Classification E-value
Superfamily C-type lectin-like 4.02e-32
Family C-type lectin domain 0.00000603
Further Details:      
 
Domain Number 2 Region: 264-330
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000264
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 3 Region: 209-273
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000612
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 4 Region: 169-206
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000939
Family EGF-type module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000007549   Gene: ENSFCAG00000008149   Transcript: ENSFCAT00000008151
Sequence length 384
Comment pep:novel genescaffold:CAT:GeneScaffold_4810:288031:306975:-1 gene:ENSFCAG00000008149 transcript:ENSFCAT00000008151 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESGRTKEGMSKAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXFLARHGTDCWTYHYSETPM
NWAKARKFCQENYTDLVAIQNKGEIEYLEQTLPFSRYYYWIGIRKVGGTWTWVGTNKSLT
KEAENWGRGEPNNKKSKEDCVEIYIKRAKDAGKWNDDSCHKQKRALCYTASCQPSSCSNH
GECVETINNYTCNCDVGYYGPQCQFVVQCEPLEAPDLGTMDCSHPVGTFSFSSQCTFNCS
KGTDLIGVEETTCGPFGNWSSLEPTCQTISCKPLMAPDLGTMDCSHPLANFSFTSTCTFN
CLEGTELIGERKIICGPSGIWSSPSPICQKVDQSFSMIKEGNYNPLFIPVAVMVTAFSGL
AFIIWLARRLKKGKKSRESVDDPY
Download sequence
Identical sequences ENSFCAP00000007549 9685.ENSFCAP00000007549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]