SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000007998 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000007998
Domain Number 1 Region: 40-99
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.35e-25
Family KRAB domain (Kruppel-associated box) 0.00091
Further Details:      
 
Domain Number 2 Region: 339-396
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.37e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 423-480
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.17e-24
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 4 Region: 479-536
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.03e-23
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 5 Region: 283-340
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.81e-23
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 6 Region: 246-297
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.41e-17
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 7 Region: 525-577
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.72e-16
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 8 Region: 386-418
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000117
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000007998   Gene: ENSFCAG00000008627   Transcript: ENSFCAT00000008630
Sequence length 586
Comment pep:novel genescaffold:CAT:GeneScaffold_4408:72983:112037:1 gene:ENSFCAG00000008627 transcript:ENSFCAT00000008630 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METPAPKPQETXXXXXXXXXXXXXXXXXXXXXXXXXXXXXESVTFKDVAVDFTQEEWGQL
DSPQRALYRDVMLENYQNLLALGPPVCKPDVISHLERGEEPWWMPREAPGGAWPEGEPGH
EVKDESCQRQGVHKEEPYQEPITEQPLGNGWARERPAASLVRGEATLQRPVPTSCRDIPG
EAFPSGRTLFTPQNIPEEGPLMGPEGFRSGGSHEAPEGAGRGPCKSGDPVNIWPQRRRVA
ASGDGLFVCSECGKAFRQSSSLTLHRRWHAREKAYKCHECGKAFTWSTNLIEHQRIHTGE
KPFFCGECGKAFSCHSSLNVHHRIHTGERPYKCSACEKAFSCSSLLNMHLRVHTGEKPYQ
CGACGKAFNQRTHLTRHQRIHTGEKPYKCSACGKAFTCHSSLTVHEKIHNGDKPFKCGDC
DKAFNSRSRLTLHQRIHTGEKPFKCGACGKAFSCHSYLVVHQRIHSGEKPFKCNECGKAF
SSHSYLIVHQRIHTGEKPFDCSRCWKAFSCHSSLIVHQRIHTGEKPYKCGECGKAFSQNH
CLIKHQKVHAGEKSFRCNECGEMFGWSAHLAEHQRQHSEEKPFAIQ
Download sequence
Identical sequences 9685.ENSFCAP00000007998 ENSFCAP00000007998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]