SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000007999 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000007999
Domain Number 1 Region: 128-172
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000226
Family Laminin-type module 0.0046
Further Details:      
 
Domain Number 2 Region: 29-77
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000243
Family Laminin-type module 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000007999
Domain Number - Region: 1-31
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000103
Family Laminin-type module 0.026
Further Details:      
 
Domain Number - Region: 93-130
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00142
Family Laminin-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000007999   Gene: ENSFCAG00000008629   Transcript: ENSFCAT00000008631
Sequence length 329
Comment pep:novel genescaffold:CAT:GeneScaffold_2204:263452:354384:-1 gene:ENSFCAG00000008629 transcript:ENSFCAT00000008631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QCKVGVTGSTCDRCQDGYYDFSKSGCLPCQCNNRSATCDALTGACLNCQENSKGDHCEEC
REGFYQSPDATKECLRCPCSAVTSTGSCIIKLGDLEPTCVQCKDGYTGRNCNTCGNGYYN
SDSICTKCQCHGHVDPIKTPKVCKPESGECISCLHNTTGFWCENCLEGYVRDLEGNCVKK
EVIVPTPEGSTILVSNASLTTSVPTPVIITFTPTTLQTIFSVSSAENSTSALADVSWTQF
NIIILTVIIIVVVLLMGFVGAVYMYREYQNRKLNAPFWTIELKEDNISFSSYHDSIPNAD
VSGLLEDDGNEVAPNGQLTLTTPIHNYKA
Download sequence
Identical sequences ENSFCAP00000007999 9685.ENSFCAP00000007999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]