SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000008393 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000008393
Domain Number 1 Region: 469-526
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-25
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 2 Region: 385-442
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.67e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 2-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.92e-25
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 4 Region: 515-567
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-20
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 5 Region: 333-386
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000022
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 6 Region: 432-464
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000976
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 7 Region: 227-276
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000182
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 8 Region: 265-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000299
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000008393   Gene: ENSFCAG00000009055   Transcript: ENSFCAT00000009057
Sequence length 576
Comment pep:novel genescaffold:CAT:GeneScaffold_4760:15331:34672:-1 gene:ENSFCAG00000009055 transcript:ENSFCAT00000009057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRSQEQVSFKDVCVDFTQEEWYLLDPAQKILYRDVILENYSHLVSVGYCFTKPEVVFKI
EQGEEPWILEAGFPSHCHQEDWKVDDLIESSQDNEDEHFWQLAFTANKTLNIDSGARVRK
TFNLGTDSVPSRNFPYKICDSCEMSLKNISGLIISRKSYSGKKPDEFNVYEKLLLDIRHE
KAPPGGKSYKYNQKRNVLHHSHDLSQPIFDQPSEYNENGQAFHAAFFTNRKYRIGETLCK
YNACGRTFIHSLELSLSQRTHLETEPYECSLCGKSFYTDLRLGHQRTLTGETPYEYDEYG
QSFCDDSTFIIHQGTYARKIPHEYKVSHKTWEKSSLFKHQIVHMGKKPYEHHENRNNFSK
KSHLTQLRRAHSGEKTFECGECGKTFWEKSNLTQHQRTHTGEKPYECTECGKSFCQKPHL
TNHQRTHTGEKPYACKQCGKTFCVKSNLTEHQRTHTGEKPYECNTCGKSFCHRSALTVHQ
RTHTGEKPFICNECGKSFCVKSNLIVHQRTHTGEKPYKCNECGKTFCEKSALTKHQRTHT
GEKPYECNGCGKTFSQRSVLTKHQRIHTRVKALSTS
Download sequence
Identical sequences ENSFCAP00000008393 9685.ENSFCAP00000008393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]