SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000008974 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000008974
Domain Number 1 Region: 335-392
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.38e-26
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 8-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.8e-24
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 3 Region: 251-308
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.35e-23
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 391-448
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.7e-23
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 5 Region: 437-489
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.28e-19
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 6 Region: 213-265
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.81e-19
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 7 Region: 162-224
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000269
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 8 Region: 298-330
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000279
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000008974   Gene: ENSFCAG00000009680   Transcript: ENSFCAT00000009680
Sequence length 507
Comment pep:novel genescaffold:CAT:GeneScaffold_4101:66727:109368:1 gene:ENSFCAG00000009680 transcript:ENSFCAT00000009680 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVRRLPTMVQESVTFKDVVVLFTQDEWAQLSPTQRALYRDVMLENYSNLVSLGLLGSQP
DVLSQLGKGEEWMLEDTSAGFCLDWMTMPVSKKSTPKADIPGEDLDRWMVKERFTRDSHW
KYDGLLEWQHGGQVAVIHQKTPSVLSDQGGDEPGKHCTESSSFVPSQGLQSSKKVFECRE
CGKVFTKSSTLNKHQKVHTEKLNANRKTVIKEKRYECRECGKAFHQSTHLIHHQRIHTGE
KPYECKECGKAFSVSSSLTYHQKIHTGEKPFECNLCGKAFIRNIHLAHHHRIHTGEKPFK
CNVCDKAFVCRAHLTKHQNIHSGEKPYKCNECGKAFNQSTSFLQHQRIHTGEKPFECNEC
GKAFRVNSSLTEHQRIHTGEKPYKCSECGKAFRDNSSFARHRKIHTGEKPYRCGLCEKAF
RDQSALAQHQRIHTGEKPYTCNICEKAFSDHSALTQHKRIHTREKPYKCKICGKAFIRST
HLTQHQRIHTGEPYCNNGGKAFQTANL
Download sequence
Identical sequences ENSFCAP00000008974 9685.ENSFCAP00000008974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]