SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000009068 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000009068
Domain Number 1 Region: 1046-1213
Classification Level Classification E-value
Superfamily C-type lectin-like 3.5e-28
Family C-type lectin domain 0.00003
Further Details:      
 
Domain Number 2 Region: 274-367
Classification Level Classification E-value
Superfamily C-type lectin-like 1.36e-25
Family Link domain 0.0053
Further Details:      
 
Domain Number 3 Region: 1214-1274
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000417
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 4 Region: 1010-1052
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000041
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 5 Region: 48-161
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000839
Family V set domains (antibody variable domain-like) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000009068   Gene: ENSFCAG00000009778   Transcript: ENSFCAT00000009780
Sequence length 1322
Comment pep:novel genescaffold:CAT:GeneScaffold_1863:1082696:1116479:1 gene:ENSFCAG00000009778 transcript:ENSFCAT00000009780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRATSVWALGLLMLQMLLFVAGEQSTQDATAAASAAANKGLHMQKVGSGLVRAALAELVA
LPCLFTLRPWPDAGREAPRIKWTKVRTASGQRQDLPILVAKDNVVRVAKGWQGRVSLPAY
PRHRANATLLLGPLRASDSGLYRCQVVRGIEDEQDLVPLEVTXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXFFYVGPELRLNLAGGRTQCSRQGAALASVGQLHLA
WHEGLDQCDPGWLADGSVRYPIQTPRRRCGGPTPGVRTVYRFANRTGFPEPGARFDAYCF
RAHHPTPPHGDPETPSSGDEGEILSAEGPPAQEVEPTLEEMVTPDFQEPLVSSGEEEPLI
LAEKQESQATRSPAPGGFVLASRPPREAEEVWPSTVAPSPSSPSTAVGAHTEATPTGPVP
RRRGRFKGLNGRHFQQQEPHRGLEVGLEASTQALTPAADHVEPLLVXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXAATETATEPTGVRDTSGSESGVFGTAESPTFGAQATTDKAQ
GTWPSLHSEGLDSHPPSAPSGVSRVLLIPGVTPSLEPWATINGEAVVGPTDSTATLAPSD
AGGIWAPGSHVVEGAESPTLSPRVAMDSSVVMSLMSVDQGDKAGVLAMSTVASSSSQPHP
EPEGQMVTQGILGALAPSQDSSPPGEPVFPPWTPTAASTDKPVSVSSGEPTVPGDSPSTP
LPASLGPEEFELEVLSGSPGVEGFWEEAASGEEPTLPGTPANGSTEEAPLDPCENNPCLH
GGTCKANGTMYGCSCDQGFAGENCEIDIDDCVSSPCENGGTCIDEVNTFVCLCLPSYGGS
LCEKDTEGCDHGWHKFQGHCYRYFAHRRAWEDAERDCRRRAGHLTSVHSPEEHSFINXXX
XXXXXXXXXXXXXXXXXXXXXXXXXQYENWRMNQPDNFFAGGEDCVVMVAHESGRWNDVP
CNYNLPYVCKKGTVLCGPPPAVQNASPIGARKAKYNVHATVRYQCDEGFTQHHVAVIRCR
SNGKWDQPQIVCTKPRRSHRMRRHHHHHQHHHQHHHHKSHKERRKHKKHPAEDWEKEEGN
FC
Download sequence
Identical sequences ENSFCAP00000009068 9685.ENSFCAP00000009068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]