SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000009091 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000009091
Domain Number 1 Region: 270-326
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.18e-22
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 2 Region: 326-382
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.18e-21
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 3 Region: 28-83
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.02e-20
Family KRAB domain (Kruppel-associated box) 0.0025
Further Details:      
 
Domain Number 4 Region: 186-242
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.22e-20
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 5 Region: 381-438
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.34e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 423-475
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2e-18
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 7 Region: 150-199
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000307
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 8 Region: 232-264
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000415
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000009091   Gene: ENSFCAG00000009801   Transcript: ENSFCAT00000009803
Sequence length 500
Comment pep:novel genescaffold:CAT:GeneScaffold_1843:145467:148761:-1 gene:ENSFCAG00000009801 transcript:ENSFCAT00000009803 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPRSAPLSARGPGEARPGRRRGRRPRAVKFADVAVYFSTEEWGCLRPAQRALYRDVMRE
TYGHLGALGCAGPKPALISWLERNTDDWEPAALDPQECPRGVAVQRKTRTRKKNGDKEVF
PPKEAPRKGKRGRRPSKPRLIPRQTSGGPICPDCGCTFPDHLALESHKCAQNLKKPYPCP
DCGRRFSYPSLLVSHRRAHSGECPYVCDQCGKRFSQRKNLSQHQVIHTGEKPYHCPDCGR
CFRRSRSLANHRTTHTGEKPHQCPSCGRRFAYPSLLAIHQRTHTGEKPYTCLECNRRFRQ
RTALVIHQRIHTGEKPYPCPDCERRFSSSSRLVSHRRVHSGERPYACEHCEARFSQRSTL
LQHQLLHTGEKPYPCPDCGRAFRRSGSLAIHRSTHTEEKLHACEDCGRRFAYPSLLASHR
RVHSGERPYACDLCSKRFAQWSHLAQHQLLHTGEKPFPCLECGRCFRQRWSLAVHKCSPR
AQNCSARSALGGASQKGDAL
Download sequence
Identical sequences ENSFCAP00000009091 9685.ENSFCAP00000009091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]