SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000009228 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000009228
Domain Number 1 Region: 616-673
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.57e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 505-561
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.15e-25
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 3 Region: 561-617
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.63e-25
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 4 Region: 393-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.36e-24
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 5 Region: 449-505
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.33e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 6 Region: 336-393
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.1e-22
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 7 Region: 283-337
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-18
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 8 Region: 662-714
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.92e-17
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 9 Region: 2-44
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.29e-17
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 10 Region: 242-271
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000214
Family Classic zinc finger, C2H2 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000009228   Gene: ENSFCAG00000009944   Transcript: ENSFCAT00000009946
Sequence length 719
Comment pep:novel genescaffold:CAT:GeneScaffold_3182:8439:23250:-1 gene:ENSFCAG00000009944 transcript:ENSFCAT00000009946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EAVTFKDVAVVFTEEELGLLDPPQRKLYREVMLENFRNLVSVXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXGRNQNEKETLHEAGVRCLSLGEFSCWQIKRHIVSKFTKDQDSKIN
VQGKSSEFPEQCDSPCQVGAGICIQASVEDSCIMNLIEDHSSILENQEFLAGRVQNSWSK
IYLSETQNYQRSCKQTQMKNQLCIFAPYVNIFSCISHHRDGDKPHNEDCGKDILKVSPLV
QQTYHCRQCEKAFNDGPSLELHQQVHSRKKSSEYGAHEKDARYSSALPIPQSVYTGKKRY
WCHECGKGFSQSSNLQTHQRVHTGEKPYSCLECGKSFNQTSHLYAHLPIHTGEKPYRCES
CGKGFSRSTDLNIHCRVHTGEKPYKCEVCGKGFTQRSHLQAHERIHTGEKPYKCGDCGKR
FSCSSNLHTHQRVHTEEKPYKCDECGKCFSLSFNLHSHQRVHTGEKPYKCEECGKGFSSA
SSFQSHQRVHTGEKPFRCNVCGKGFSQSSYFQAHQRVHTGEKPYKCEVCGKRFNWSLNLH
NHQRVHTGEKPYKCEECGKGFSQASNLQAHQSVHTGEKPFKCDACQKRFSQASHLQAHQR
VHTGEKPYKCDTCGKAFSQRSNLQVHQIIHTGEKPFKCEECGKEFSWSAGLSAHQRVHTG
EKPYTCQQCGKGFSQASHFHTHQRVHTGERPYICDVCCKGFSQRSHLVYHQRVHTGGNL
Download sequence
Identical sequences 9685.ENSFCAP00000009228 ENSFCAP00000009228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]