SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000009700 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000009700
Domain Number 1 Region: 764-940
Classification Level Classification E-value
Superfamily Fibronectin type III 8.3e-21
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 2 Region: 461-522
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000057
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 3 Region: 151-190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000214
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 4 Region: 668-746
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000681
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 5 Region: 418-461
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000191
Family EGF-type module 0.029
Further Details:      
 
Domain Number 6 Region: 1053-1090
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000703
Family EGF-type module 0.016
Further Details:      
 
Domain Number 7 Region: 308-346
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000107
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 8 Region: 79-188
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000033
Family Growth factor receptor domain 0.0092
Further Details:      
 
Domain Number 9 Region: 628-667
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000411
Family EGF-type module 0.024
Further Details:      
 
Domain Number 10 Region: 37-84
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000495
Family EGF-type module 0.0082
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000009700
Domain Number - Region: 272-302
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00591
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 532-551
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0992
Family EGF-type module 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000009700   Gene: ENSFCAG00000010450   Transcript: ENSFCAT00000010453
Sequence length 1158
Comment pep:novel genescaffold:CAT:GeneScaffold_4115:197554:274274:1 gene:ENSFCAG00000010450 transcript:ENSFCAT00000010453 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVEVETTTNVGVPGRWAFRIDDAQVRVGGCGHTTSVCLALRPCLNGGKCIDDCVTGNPSY
SCSCLSGFTGRRCHLDVNECASXXXXXXXXCTHGINSFSCRCPAGFGGPTCETALSPCDT
RECENGGRCQAESGSAVCLCQAGYTGTACETDVDECASGPCLNGGSCVDLVGNFTCLCSE
PFAGPRCETXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXTATPCNMNTQCPDGGYCMEYGGSYLCVCHTDH
NVSHSLPSPCDSDPCFNGGSCDAHEDSYTCECPRGFHGRHCEKXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRHCE
IAPSPCFRSPCSNGGTCEDLGTDFSCRCRAGYMGRRCQAEVDCGPPAEVKHATLRFNGTR
LGSVALYKCDHGYSLSSPNHVRVCQPQGVWSEPPQCHGTGHPSQLVELHGGSRQYLCVCS
TGRKGAHCELXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXSDPCFSSPCGGRGYCLASNGSHSCTCKVGYTGK
DCAKDLFPPTALKVERVEESGVSISWRPPEGQAARQMLDGYAVTYASSDGAYRRTDFVDR
SRSSHQLRALAAGRAYNISVFSVKRNANNKNDISRPVLLLTRTRPRPVEGLEVTNVTAST
ISVRWALHRIRHATVSGVRVSIRHPEAQEDQSTDMDKSVDKFTFGALLPGRRYTIHVTAL
SGLGGQEPPTESLASAPLHVWTRPLPPANLTAARVTATSAHVVWDTPTPSTLLEAYVINV
TTSQSTKSRYVPNGRLTSYTVRDLLPGRRYQLSVTAVQSAEGDQLRHREGLHPRVLRNRP
PPVRLPEHLLSDRDAPEAQTPAPRFSELVDGRGRVSAKFTGSPGKSVTVRSQPTALAQLE
NTEEAPKQAPEQVGLALQLPERSSDKDTENTPGNCSENPCQNGGTCVPGVDTHSCDCSPG
FKGRRCELACTKVPQPCTRLFSETKAVPVWEGGACHHVYKRVYKVHQDICFKESCESTGG
KKTPNRKQSNNSPTLKKS
Download sequence
Identical sequences ENSFCAP00000009700 9685.ENSFCAP00000009700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]