SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000009867 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000009867
Domain Number 1 Region: 808-998
Classification Level Classification E-value
Superfamily Nucleotide cyclase 3.14e-63
Family Adenylyl and guanylyl cyclase catalytic domain 0.00011
Further Details:      
 
Domain Number 2 Region: 535-770
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.29e-42
Family Protein kinases, catalytic subunit 0.00035
Further Details:      
 
Domain Number 3 Region: 40-424
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.3e-39
Family L-arabinose binding protein-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000009867   Gene: ENSFCAG00000010629   Transcript: ENSFCAT00000010632
Sequence length 1071
Comment pep:novel genescaffold:CAT:GeneScaffold_350:32684:124598:-1 gene:ENSFCAG00000010629 transcript:ENSFCAT00000010632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKMTLLGLVLWSLLLHPGLMFWTSQISQNCNNGSYEISVLMMNNSAFPETLDTLKEAVNE
GVQIVRQRLLNAGINVTVNATFLYSNSLIYKSSDCRSSTCEGLDLLREISNKKQMGCVLV
GPSCTYSFQMYLDTDLNYPMISAGSFGLSCDYKETLTRLLSPARKLIYFLVNFWKANNLP
FKNFSWNTAYVFKNGTETEDCFWYLNALEAGVSYFSQELSFKDMLRGNDQFQDILMNQNR
KSNVIVVCGTPDTINSLKGDREVAEDIVIILVDLFXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXAKNDFALAYLNGVLLFGHMLKIFLENGEAITTPKFAHAFKNLTFE
XXXXXXXXXXXXXXXNTMMLLYTSVDTNKYNVLLTYDTHVNRTTPKEETPTFIWKNHKLP
NDIPGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLLQMDY
YNLTKFYGTVKLDTMIFGVIEYCERGSLREVLNDTISYPDGTFMDWEFKISVLYDIAKGM
SYLHSSKTEVHGRLKSTNCVVDSRMVVKITDFGCSSILPPTKDLWTAPEHLRQASISQKG
DVYSYGIIAQEIILLRETFYTLSCRDENEKIFRVENSNGVKPFRPDLFLETAEEKELEYL
LVKNCWEEDPEKRPDFKKIESTLAKIFGLFHDKKNESYMDTLIRRLQLYSRNLEHLVEER
TQLYKAERDRADRLNFMLLPRLVVKSLKEKGIVEPELYEEVTIYFSDIVGFTTICKYSTP
MEVVDMLNDIYKSFDHILDHHDVYKVETIGDAYMVASGLPKRNGNRHAIDIAKMALDILS
FMGTFELEHLPGLPIWIRIGVHSGPCAAGVVGIKMPRYCLFGDTVNTASRMESTGLPLRI
HVSGSTIAILKRTECQFLYEVRGETYLKGRGTETTYWLTGVKDREYNLPTPPTVXXQQRL
QAEFSDMIANSLQKRQAAGIRSRKPTRVASYKKGTLEYLQLNTTDKENTHF
Download sequence
Identical sequences ENSFCAP00000009867 9685.ENSFCAP00000009867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]