SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000009986 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000009986
Domain Number 1 Region: 46-139
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.74e-38
Family SCAN domain 0.0000663
Further Details:      
 
Domain Number 2 Region: 611-668
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-25
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 3 Region: 555-612
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.31e-24
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 4 Region: 471-528
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.46e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 5 Region: 415-472
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.19e-24
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 6 Region: 657-709
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.54e-21
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 7 Region: 363-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.84e-20
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 8 Region: 518-550
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000332
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 9 Region: 225-273
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000772
Family KRAB domain (Kruppel-associated box) 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000009986   Gene: ENSFCAG00000010750   Transcript: ENSFCAT00000010753
Sequence length 710
Comment pep:novel scaffold:CAT:scaffold_5829:4500:14372:1 gene:ENSFCAG00000010750 transcript:ENSFCAT00000010753 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATQGRGTLGLIPRGAVLQKQEWRQTMKQEPGSQTWGQACNLQKNHPPVCEIFRLHFRQL
CYHEMSGPQEALSRLRELCHWWLMPEVHTKEQILELLVLEQFLTILPGELRTWVQLHQPE
NGEEAVAVVEDFQRHLSGPGEVSTPAQEQEIHLEETTALGTSEEFLPTSPLSEGSAPEAH
LEPPQDPGTYLLHNGHSGQCASQVPAVSQAGKSGDQAAATVLRMVRPQGSAAYEFLSVDY
TERKWKGPALSQRAVYRSLMPENYRRVASLANETRMECPDLPAKQEVSKGLGSSDGTSGG
LCGVVSGEPEARTVCEGALEKLEGQPSDEEGSRLESDFFKLTHKDKGKSTKDGCDEYKDP
NLSSSATEHQRVLKGQKFYQCDECGKAFNRNSHFIGHQRIHTGEKPYECNECGKTFRQTS
QLIVHLRTHTGEKPYECSECGKTYRHSSHLIQHQRLHNGEKPYKCNECAKAFTQSSQLID
HQRTHTGEKPYECSECGEAFIRSKSLVRHQVLHTGKKPYKCGECGKAFCSNRNLTDHQRI
HTGEKPYECNECGKAFSRSKCLIRHQSLHTGEKPYKCSECGKAFSQISQLVDHERIHTGE
KPFECNECGKAFSLSKCLIRHQRLHTGEKPYKCNECGKSFNQNSYLIIHQRIHTGEKPYE
CNECGKVFSHNSSLMVHQRTHTGEKPYKCNDCGKAFSDSSQLTVHQRVHT
Download sequence
Identical sequences 9685.ENSFCAP00000009986 ENSFCAP00000009986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]