SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000010180 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000010180
Domain Number 1 Region: 55-87
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000198
Family EGF-type module 0.021
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000010180
Domain Number - Region: 13-45
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00324
Family EGF-type module 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000010180   Gene: ENSFCAG00000010956   Transcript: ENSFCAT00000010961
Sequence length 684
Comment pep:novel genescaffold:CAT:GeneScaffold_3250:162642:284202:-1 gene:ENSFCAG00000010956 transcript:ENSFCAT00000010961 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IVGFSTLLNCSYTQNCTKTPCLPNAKCEIRNGIEACYCNMGFSGNGVTICEDDNECGNLT
QSCGENANCTNTEGSYYCMCAPGFRSSSNQDRFITNDGTLCIENVSADCHLDNACIAANI
DKMLTKIRHIKEPVALLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXLKAFCFDSNHMKYIHPHMNVDGDYIKIFPKRKAAYDSYGNVAVTFLYYKSIG
PLFSSSDNFLLEPQSYDNSEEEERVVSSVISVSISSNPPTLYELEKITFTLSHIKXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XLFCSIIAGLLHYFFLAAFAWMCIEGIHLYLIVVGVIYNKGFLHKNFYIFGYLSPAVVVG
FSASLGYRYYGTTKVXXXXXXXXXXXXXXXXXXXXXXVNLLAFGFIIYKVFRHTAGLKPE
VSCYENIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXIQEEYYRLFKNVPCCFGCLR
Download sequence
Identical sequences 9685.ENSFCAP00000010180 ENSFCAP00000010180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]