SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000010367 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000010367
Domain Number 1 Region: 2145-2271
Classification Level Classification E-value
Superfamily Cadherin-like 1.96e-29
Family Cadherin 0.0011
Further Details:      
 
Domain Number 2 Region: 2662-2772
Classification Level Classification E-value
Superfamily Cadherin-like 1.08e-28
Family Cadherin 0.00029
Further Details:      
 
Domain Number 3 Region: 463-585
Classification Level Classification E-value
Superfamily Cadherin-like 5e-28
Family Cadherin 0.00091
Further Details:      
 
Domain Number 4 Region: 682-785
Classification Level Classification E-value
Superfamily Cadherin-like 5.28e-28
Family Cadherin 0.001
Further Details:      
 
Domain Number 5 Region: 3392-3512
Classification Level Classification E-value
Superfamily Cadherin-like 9.71e-28
Family Cadherin 0.0013
Further Details:      
 
Domain Number 6 Region: 575-681
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-25
Family Cadherin 0.00089
Further Details:      
 
Domain Number 7 Region: 881-985
Classification Level Classification E-value
Superfamily Cadherin-like 4.19e-25
Family Cadherin 0.0028
Further Details:      
 
Domain Number 8 Region: 2766-2864
Classification Level Classification E-value
Superfamily Cadherin-like 2.49e-22
Family Cadherin 0.0017
Further Details:      
 
Domain Number 9 Region: 788-893
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-22
Family Cadherin 0.0021
Further Details:      
 
Domain Number 10 Region: 2976-3079
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-22
Family Cadherin 0.0012
Further Details:      
 
Domain Number 11 Region: 2864-2974
Classification Level Classification E-value
Superfamily Cadherin-like 1.31e-21
Family Cadherin 0.0023
Further Details:      
 
Domain Number 12 Region: 3502-3605
Classification Level Classification E-value
Superfamily Cadherin-like 9.55e-21
Family Cadherin 0.0017
Further Details:      
 
Domain Number 13 Region: 3291-3396
Classification Level Classification E-value
Superfamily Cadherin-like 1.34e-20
Family Cadherin 0.0019
Further Details:      
 
Domain Number 14 Region: 2563-2668
Classification Level Classification E-value
Superfamily Cadherin-like 2.09e-19
Family Cadherin 0.0057
Further Details:      
 
Domain Number 15 Region: 2251-2340
Classification Level Classification E-value
Superfamily Cadherin-like 8.71e-19
Family Cadherin 0.0028
Further Details:      
 
Domain Number 16 Region: 3084-3163
Classification Level Classification E-value
Superfamily Cadherin-like 4.28e-18
Family Cadherin 0.00098
Further Details:      
 
Domain Number 17 Region: 346-467
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-16
Family Cadherin 0.0013
Further Details:      
 
Domain Number 18 Region: 3803-3816,3847-3931
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000251
Family Growth factor receptor domain 0.0077
Further Details:      
 
Domain Number 19 Region: 2482-2556
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000523
Family Cadherin 0.016
Further Details:      
 
Domain Number 20 Region: 3228-3297
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000942
Family Cadherin 0.0047
Further Details:      
 
Domain Number 21 Region: 1975-2028
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000214
Family Cadherin 0.0014
Further Details:      
 
Domain Number 22 Region: 68-135
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000457
Family Cadherin 0.0086
Further Details:      
 
Domain Number 23 Region: 129-188
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000002
Family Cadherin 0.0075
Further Details:      
 
Domain Number 24 Region: 4164-4197
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000792
Family EGF-type module 0.021
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000010367
Domain Number - Region: 3607-3694
Classification Level Classification E-value
Superfamily Cadherin-like 0.000357
Family Cadherin 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000010367   Gene: ENSFCAG00000011159   Transcript: ENSFCAT00000011163
Sequence length 4979
Comment pep:novel genescaffold:CAT:GeneScaffold_4619:152230:319739:1 gene:ENSFCAG00000011159 transcript:ENSFCAT00000011163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLAADGAPGRPWLQLPTLSVFQLLRVFWLLSQLPGPARVSGAEQRQVFQVLEEQPPGTL
VGTIQTRPGFTYRLSESHALFAINSSTGALYTTATIDRESLPSDVINLVVLSSSPTYPTE
VRVLVRDLNDNAPVFPDPSIVVTFKEDSSSGRQVILDTATDSDIGSNGVDHRSYRIIQGN
EAGRFRLDITLNPSGEGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGRAEALIQLLDVNDNDPVVKFRYFPA
TSRYASVDENAQVGTVVALLTVTDADSPAANGNISVQILGGNEQRHFEVQSSKVPNLSLI
KVASALDRERIPSYNLTVSVSDNYGAPPGAAVQARSSVASLVIFVNDINDHPPVFAQQVY
RVNLSEEAPPGSYVSGVSATDGDSGLNANLRYSIVSGNGLGWFHISEHSGLVTTGVAGGL
DRELASQIVLNISARDQGVHPKFSYAQLVVTLLDVNDEKPVFSQPEGYDVSVVENAPTGT
ELLVLRATDRDLGDNGTVRFSLQEAETDQRSFRLDPVSGRLSTVTSLDREEQAFYSLLVL
ATDLGSPPQSSMARINVSLLDMNDNSPVFYPVQYFAHIQENEPGGSYITTVSATDPDLGL
NGTVKYSISAGDRSRFQVNAQSGVISTRMALDREEKTAYQLQIVATDGGNLQSPNQAIVT
ITVLDTQDNPPVFSQAAYSFVVFENVALGYHVGSVSASTMDLNANISYLITTGDQKGMFA
INQVTGQLTTASVIDREEQSFYQLKVVASGGTVTGDTMVNITVKDLNDNSPHFLQAVESV
NVVENWQAGHSIFQAKAVDPDEGVNGMVLYSLKQNPKNLFTINEKNGNISLLGPLDVHAG
SYQIEIVASDMGVPQLSSSFILTVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXINSQLA
YSIASGDSLGQFTVDKNGVLKVLKSLDRESQSFYNLVVQAHDLPQLPASXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDIKDNNPVFVQAYKV
EINENTLTGTDIIQVYAADGDEGTNGQVRYGIVDGNANQEFRIDSVTGAITVAKPLDREK
TPTYSLTVQATDRGSNPRTDTSTVSIVLLDINDFVPMFELSPYSVNVPENLGTLPRTILQ
VVARDDDQGPNSKLSYVLFGGNEDNAFTLSASGELQVTQSLDRETKEHFVLMITATDSXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXSFVFAVTVTDADIGPNSELHYSLSGRNSEKFHIDPLRGA
IMAAGPLNGASEVTFSVHVKDGGSFPKTDSTTVTVRFVNKADFPKVRAKEQTFMFPENQP
VGTLVTTVTGSSLRGEPLSYYIASGNLGSTFQIDQLTGQVSISQPLDFEKIQKYVIWIEA
RDGGFPPLSSYEKLDLTVLDVNDNSPVFKEDPFVSEILENLSPRKILTVSAMDKDSGPNG
QLDYEIVNGNKEHSFTINHATGEIRSIRSLDREKISQYVLTIKSSDKGSPSQSTSVKVII
NILDENDNAPRFSQIFSAYVPENSPLGYTVTRVTTSDEDIGVNAISRYSITDTSLPFTIN
PSTGDIVISRPLNREDTDRYRIRVSAHDSGWTVSTDVTIFVTDVNDNAPRFSRPSYYLDC
PELTEIGSKVTQVSATDPDEGSNGQVFYFIKSQSEYFRINATTGEIFNKQVLKYQNVSGT
SNVNINRHSFIVTSSDRGNPSLLSETTVTINTVDSNDNAPQFLKGKYFTPVTKNVKVGTK
LIKVTAVDDRDFGLNSEVEYLISNENHFGKFKLDNSTGWISVASSLISDLNQNFVITVTA
RDKGNPPLSSQATVQIIVTEENYHTPEFSQSHMSATIPESHSIGAIVRTVSARDRDAAMN
GLIRYSISSGNEEGIFAINSSTGILTLAKALDYELCQKHEMTXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVIAYTVQSSDSDLF
VIDPNTGVITTQGFLDFETKQSYHLTVKAFNVRDEERCSFATVNIQLKGTNEYVPRFVSK
LYYFEISEAAPKGTIVGEVFASDRDLGTDGEVQYLIFGNSRKKGFQINKKTGQIYVSGLL
DREKEERVSLKVLAKNSGSIRGADIDEVTVNVTVLDANDPPIFSLNIYSVQISEGVPTGT
HVTFVSAFDSDSVPSWSRFSYFIGSGNENGAFSINPQTGQITVTAELDRETLPVYNLTVL
AIDSGTPSATGSASLLVTLEDINDNGPMLTISEGEVMENKRPGTLVMTLQSTDPDLPPNQ
GPFTYYLLSTGPATNYFSLNTAGVLSTTREIDREQIADFYLSVITRDSGVPQMSSTGTVH
ITVIDQNDNPSQSRTVEIFVNYYGNLFPGGILGSVKPQDPDVLDTFHCSLTSGVTSLFSI
PRGTCDLNSQPRSTDGTFDLTVLSSDGVHSTVTSNIRVFFAGFSNATVDNSILLRLSIPT
VKDFLTNHYLHFLRIASSQLTGLGTAVQLYGAYEENNRTFLLAAVKRNNNQYVNPSGVAT
FFESIKEILLRQSGVKVESVDHDSCVHGPCQNGGSCIRRLAVSSVLKSHESLPVIIVANE
PLRPFLCKCLPGYAGSWCEIDIDECLPSPCHNGGTCHNLVGGFSCSCPDGFTGRACERDV
NECLPGPCKNGAVCQNVPGSFNCVCKTGYTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXCPRLEGACTHSPCQHGGICTDYWSWQHCHWKEGLTGKYCEKXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXIKNGKVHFTSDAGIAGKVERNIPVYVAXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGFDGCIASMLYGGESLPFSGKH
SLASISKTDPSVKIGCRGPNICASNPCWGDLLXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXRRPLSRTGNPADGIPAPESSSDSDSHESFTCSEMEYDREKPMV
YTSRMPKLSQVNESDADDEDNYGARLKPRRYHGRRAEGGPGGTQAAAPGVADNTLPLKLG
QQAGNFNWDNLLNWGPGFGHYVDVFKDLASLPEKAAANEEGKNGTAKPVPKDGESEQYV
Download sequence
Identical sequences 9685.ENSFCAP00000010367 ENSFCAP00000010367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]