SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000010809 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000010809
Domain Number 1 Region: 175-231
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.56e-25
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 2 Region: 314-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.44e-24
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 3 Region: 260-314
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 369-426
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-23
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 5 Region: 7-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.62e-21
Family KRAB domain (Kruppel-associated box) 0.0019
Further Details:      
 
Domain Number 6 Region: 415-467
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.53e-20
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 7 Region: 122-175
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.53e-18
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 8 Region: 221-253
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000457
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000010809   Gene: ENSFCAG00000011646   Transcript: ENSFCAT00000011649
Sequence length 469
Comment pep:novel genescaffold:CAT:GeneScaffold_4145:160457:165184:-1 gene:ENSFCAG00000011646 transcript:ENSFCAT00000011649 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATLLMAGSQAPVTFEDMAMYLTREEWRPLDPTQRDLYRDVMQENYGNVVSLDFEIRSE
NEVNPKQEISEDVEFGTASERPVGNAEENPENEEAFESRERPERQWGDLTAEEWVSYPLQ
QVTDLLVHKEVHTGIRYHICSHCGKAFSQISDLNRHQKTHTGDRPYKCYECGKGFSRSSH
LIQHQRTHTGERPYDCNECGKSFGRSSHLIQHQTIHTGEKPHKCNECGKSFCRLSHLIQH
QRTHSGEKPYECEECGKSSRSSHLAQHQRTHTGEKPYECNECGRGFSERSDLIKHYRVHT
GERPYKCDECGKNFSQNSDLVRHRRAHTGEKPYHCNECGENFSRISHLVQHQRTHTGEKP
YECNACGKSFSRSSHLITHQKIHTGEKPYECNECWRSFGERSDLIKHQRTHTGEKPYECV
QCGKGFTQSSNLITHQRVHTGEKPYECTECEKSFSRSSALIKHKRVHTD
Download sequence
Identical sequences 9685.ENSFCAP00000010809 ENSFCAP00000010809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]