SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000011015 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000011015
Domain Number 1 Region: 385-441
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.91e-26
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 2 Region: 329-385
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.53e-25
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 440-497
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.09e-23
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 4 Region: 272-329
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-21
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 5 Region: 16-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.59e-20
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 6 Region: 482-534
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.9e-18
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 7 Region: 219-273
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.28e-16
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 8 Region: 176-219
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000253
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000011015   Gene: ENSFCAG00000011872   Transcript: ENSFCAT00000011875
Sequence length 545
Comment pep:novel genescaffold:CAT:GeneScaffold_4640:2185:6761:-1 gene:ENSFCAG00000011872 transcript:ENSFCAT00000011875 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSPGYQAMATLHLSALPQAEVTFEDVAVLFSREEWGRLGPTQRGLYRDVMLETYRNLVSL
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRGTRTEYSELSSGEMLDGE
DSQGPEPGEARACVREPEDSLDEPVEQRCLRPVTWTNEESIQESARSLSFQSSPISDQRP
HKCDICEQSFEQRSYLNNHKRVHRTKKINVVHDSGEFFSANLAKEAQIIPLGKKLHHCGY
CGKAFRYSANLVKHQRLHSEEKPYKCEECGKAFGQSCEFISHRRMHSGEIPYRCGECGKT
FNQRPNLMKHQRIHTGEKPYKCGDCGKHFSAYSSLIYHQRIHTGEKPYKCNDCGKAFSDG
SILIRHRRTHTGEKPFECKECGKGFTQSSNLIQHQRIHTGEKPYKCNECEKAFIQKTKLV
EHQRSHTGEKPYECNDCGKVFSQSTHLIQHQRIHTGEKPYKCSECGKAFHNSSRLIHHQR
SHHGEKPYKCSDCKKAFSQGTYLIQHRRIHTGEKPYKCSKCGKAFRHSSNMCQHQRIHLR
EDFAR
Download sequence
Identical sequences ENSFCAP00000011015 9685.ENSFCAP00000011015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]