SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000011374 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000011374
Domain Number 1 Region: 480-591
Classification Level Classification E-value
Superfamily SH2 domain 3.1e-31
Family SH2 domain 0.000000792
Further Details:      
 
Domain Number 2 Region: 169-256
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.53e-26
Family Ras-binding domain, RBD 0.00017
Further Details:      
 
Domain Number 3 Region: 283-400
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000063
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000011374   Gene: ENSFCAG00000012260   Transcript: ENSFCAT00000012262
Sequence length 594
Comment pep:novel genescaffold:CAT:GeneScaffold_193:562358:810076:-1 gene:ENSFCAG00000012260 transcript:ENSFCAT00000012262 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALAGCPDSFLHHPYHQDQVEQTPPVSPRDLAGPGFPAQPDRLTNHQEDDVDLEALVNDV
SASLESLYPACSMQSETVPLLQNGQHARSQPPPSGTRSLQPQASPRLQVQRSQPVHILAV
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVKIFSEDGTSK
VVEILADMTARDLCQLLVYRSHCVDDNSWTLVEHHPHLGLERYLEDHELVVQVESTLASD
SKFLFRKNYAKYEFFKNPTNFFPEQMVTWCQQPNGGHNQLLQNFLNCSSCPEIQGFLHVK
DLGKKSWRKLYVCLRRSGLYCSTKGVSKEPRHLQLLAGLEDSSIFSLIAGRKQYCAPTDY
GFCIKPNKVRSETKELRLLCAEDEQGRTCWMTACRLLKXXXXXXXXXXXXXXXXXXXXXX
XXXXRSVSENSLVAMDFSGQTGRVIENPAEAQSAALEEGHAWRKRSTRMNILSSQSPLQP
STLSTVIHRTQHWFHGHISREESHRIIKQQGLVDGLFLLRDSQSNPKAFVLTLCHHQKIK
NFQILPCEDDGQIYFSLDDGNTKFSDLIQLVDFYQLNKGVLPCKLRHHCIRVAL
Download sequence
Identical sequences ENSFCAP00000011374 9685.ENSFCAP00000011374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]