SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000011818 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000011818
Domain Number 1 Region: 1045-1269
Classification Level Classification E-value
Superfamily Kelch motif 4.58e-30
Family Kelch motif 0.02
Further Details:      
 
Domain Number 2 Region: 1312-1430
Classification Level Classification E-value
Superfamily Kelch motif 0.0000000000114
Family Kelch motif 0.013
Further Details:      
 
Domain Number 3 Region: 752-800
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000398
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 4 Region: 615-650
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000215
Family EGF-type module 0.01
Further Details:      
 
Domain Number 5 Region: 704-752
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000151
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 6 Region: 1783-1833
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0001
Family Laminin-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000011818
Domain Number - Region: 1711-1746
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000221
Family EGF-type module 0.091
Further Details:      
 
Domain Number - Region: 2058-2068
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00246
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Domain Number - Region: 955-1022
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00494
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000011818   Gene: ENSFCAG00000012745   Transcript: ENSFCAT00000012749
Sequence length 2375
Comment pep:novel genescaffold:CAT:GeneScaffold_955:498067:536140:1 gene:ENSFCAG00000012745 transcript:ENSFCAT00000012749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVYGGNVHTHYQEEKCYEDGLFFYHLGCHQWVSGAELAPPGTPEXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXCPAASCLGLGRLLGDCQACLAFSGPTTPPRGPGPLGWCVHNES
CLPRPEQARCRGEQISGTVGWWGPAPVFVTSLEACVTQSFLPGLHLLTFQQPPNASQPDK
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSAGPGHSE
LTLLWDRTGVPGGSEISFFFLEPYRSSACSSYSSCLGCLADQGCGWCLTSATCHLRQSGA
HCGDDRTGGSLLVLEPALCPLCEEHRDCHACTQXXXXXXXXSTSRKGDAACSRRGRSRGA
LKSPEECPPLCSQRLTCDDCLANSSQCAWCQSTHTCFLFAAYLARYPHGGCRGWDDSVHS
EPRCRSCDRFLTCHECLQSHECGWCGNEDNPTLGRCLQGDFSGPLGGGNCSLWVGEGLGL
SVALPARWAYARCPDVDECRLGLARCHLRATCLNTPLSYECHCQRGYQGDGITYCNRTCL
EDCGHGVCSGPPDFTCVCDLGWTSDLPPPTPAPGPPAPRCSRDCGCNFHSHCRRRGPGFC
DECQDWTWGEHCERCRPGSFGNATGSGGCRPCQCNGHGDPRRGHCDNLSGLCFCQDHTEG
AHCQLCSPGYYGDPRAGGSCFRECGGRALLTNVSSVALGSRRVGGLLPPGGGAARAGPGL
SYCVWVVSATEVLQPCAPGTLCPPLTLTFSPDSSTPCTLSYVLAFDGFPRFLDTGVVQSD
RSLIAAFCGQRRDRPLTVQALSGLLVLHWEANGSSSWGFNASVGSARCGSGGPGSCPVPQ
ECVAQDGAAGAGLCRCPQGWAGPHCRMALCPENCNAHSGAGNCNQSLGVCICGEGFGGPE
CAKKLDGGQLVWETLMDSRLSADTASRFLHRLGHTMVEGPDATLWMFGGLGLPQGLLGNL
YRYSVSERRWTQMLAGAEDGGPGPSPRSFHAAAYVSAGRGAMYLLGGLTAGGVTRDFWVL
NLTTLQWRQEKVPQTVDLPAVAGHTLTARRGLILLLVGGYSPENGFNQQLFEYQLVTGTW
VSGAQSGTPPTGLYGHSAVYHEATDSLYVFGGFRFHVELAAPSPELYSLHCPDRTWSLLA
PSQGAKQGHTRNDSSQGQCQVPGEAWGFGEFGREMALGAALKSEGGFLEKEPRPRLFHAA
ALLGDTMVVLGGRSDPDEFSSDVLLYQVNCNAWLLPDLTRPASVGPPMEESVAHAVAAVG
GRLYISGGFGGVALGRLLALTLPPDPCRLLPSPEACNQSGACTWCHGACLSGDQAHRLGC
GGPPCSPMPHSPEECRRLRTCSECLARHPRTLQPGDGEASAPRCKWCTNCPEGACIGRNG
SCTSENDCRINQREVFWAGNCSEAVCGAADCEQCTREGKCMWTRQFKRTGETRRILSVQP
TYDWTCFSHSLLNVSPMPVESSPPLPCPTPCHLLPNCTSCLDSKGADGGWQHCVWSSSLQ
QCLSPSYLPLRCMAGGCGRLLRGPESCSLGCAQATQCALCLRRPHCGWCAWGGQDGGGRC
LEGGLSGPRDGLTCGRPGASWAFLSCPPEDECANGHHDCNETQNCHDRPHGYECSCKAGY
TMDNMTGLCRPVCAQGCVNGSCVEPDHCRCHFGFVGRNCSTECRCNRHSECAGVGARDHC
LLCRNHTKGSHCEQCLPLFVGSAVGGGTCRPCHAFCRGNSHVCISRKELEMARKEPEKYS
LDPEEXXXXXXXXXXXXXXXXXXXQNNSYGDKCESCLHGYFLLDGKCTKCQCNGHADTCN
EQDGTGCPCQNNTETGTCQGSSPSDRRDCYKYQXXXXXXXXXGSPLGGQQCYRLISVEQE
CCLDPTSQTNCFHEPKRRALGPGRTVLFGVQPKFTNVDIRLTLDVTFGAVDLYVSTSYDT
FVVRVAPDTGVHTVHIQPPPPPPPPPPPADGGPRGAGDPGGPGAGSGPGAPAEPRVREVW
PRGLITYVTVTEPSAVLVVRGVRDRLVITYPHEHHALKSSRFYLLLLGVGDPSGPGANGS
ADSQGLLFFRQDQAHIDLFVFFSVFFSCFFLFLSLCVLLWKAKQALDQRQEQRRHLQEMT
KMASRPFAKVTVCFPPDPAAPAPAWKPAGLPPPTFRRSEPFLAPLLLTGAGGPWGPVGGG
CCPPAVPATTAGLRAGPITLEPTEDGMAGVATLLLQLPGGPQAPNGACLGSALVTLRHRL
HEYCGGGGGAGGSGHGAGAGRKGLLSQDNLTSMSL
Download sequence
Identical sequences ENSFCAP00000011818 9685.ENSFCAP00000011818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]