SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000012038 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000012038
Domain Number 1 Region: 541-651
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-36
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 2 Region: 272-382
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-35
Family Spermadhesin, CUB domain 0.00078
Further Details:      
 
Domain Number 3 Region: 431-494
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000157
Family Spermadhesin, CUB domain 0.0017
Further Details:      
 
Domain Number 4 Region: 832-925
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000131
Family Spermadhesin, CUB domain 0.0068
Further Details:      
 
Domain Number 5 Region: 75-134
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.000000000000403
Family Astacin 0.0088
Further Details:      
 
Domain Number 6 Region: 194-269
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.00000000002
Family Astacin 0.019
Further Details:      
 
Domain Number 7 Region: 496-539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000214
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 8 Region: 649-693
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000347
Family EGF-type module 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000012038   Gene: ENSFCAG00000012979   Transcript: ENSFCAT00000012983
Sequence length 936
Comment pep:novel genescaffold:CAT:GeneScaffold_3151:173515:253366:1 gene:ENSFCAG00000012979 transcript:ENSFCAT00000012983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AFLGDIALDEEDLRAFQVQQAEDLRQRATHRSSIKTTAPGNSSTPNCQSTSGQPQRRNRG
RWRSRSRSRRAATSRPERVWPDGVIPFVIGGNFTGSQRAVFRQAMRHWEKHTCVTFLERT
DEDSYIVFTYRPCGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXQEYNFLKMELQEVESLGETYDFDSIMHYARNTFSRGIFLDTIVPKY
EVNGVKPPIGQRTRLSKGDIAQARKLYKCPACGETLQDSTGNFSSPEYPNGYSAHMHCVW
RISVTPGEKIILNFTSMDLYRSRLCWYDYVEVRDGFWRKAPLRGRFCGGKLPEPIVSTDS
RLWVEFRSSSNWVGKGFFAVYEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXIERHDSCAYHYLEVRDGHSESSTLIGRYCGYEKSDDIKSTSCSLWLKFV
SDGSLNKAGFAVNFFKEVDECSRPNRGGCEQRCLNTLGSYKCSCDPGYELAPDKRRCEAA
CGGFLTKLNGSITSPGWPKEYPPNKNCIWQLVAPTQYRISLQFDFFETEGNDVCKYDFVE
VRSGLTADSKLHGKFCGSEKPEVITSQYNNMRVEFKSDNTVSKKGFKAHFFSDKDECSKD
NGGCQQDCVNTFGSYECQCRSGFVLHDNKHDCKEXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXCGGQVRAEVKTKDLYSHAQFGDNNYLGGVDC
ESVIVADEGYGVELALQIIEMDDNTDCGYDYVXXXXXXXXXXXXXXXXXXXXPPEEVYSA
GDSVLVKFHSDDTITKKGFHLRFTSTKFQDTLHSKK
Download sequence
Identical sequences ENSFCAP00000012038 9685.ENSFCAP00000012038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]