SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000012702 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000012702
Domain Number 1 Region: 510-567
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.52e-25
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 2 Region: 398-455
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.05e-22
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 3 Region: 454-511
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.03e-21
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 4 Region: 2-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.18e-21
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 5 Region: 342-399
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.69e-21
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 6 Region: 610-670
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.13e-18
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 7 Region: 305-356
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.13e-16
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 8 Region: 566-623
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.34e-16
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000012702
Domain Number - Region: 241-267
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000512
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000012702   Gene: ENSFCAG00000013694   Transcript: ENSFCAT00000013698
Sequence length 683
Comment pep:novel genescaffold:CAT:GeneScaffold_5186:132551:141041:1 gene:ENSFCAG00000013694 transcript:ENSFCAT00000013698 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSVSFEDVTMDFSREEWEQLGPTQRCLYWDVMLEICSHLLSLGYPIPRPEMIFRMEKEEE
PWIREAQLPHQWHPEGEFGLKTSRQKIFEKASFRDGKELAAPGGGSRCSVLGDVNPTTRG
LQKQGEPSRHGALLSRETPDTERDSGCKDPGKITPVRPHLVSPQKRPPKRGSFAKSLKPN
LEGSPQKQIDGTEHLDGTVGSGRLSPHSPSGPGYKNVRPGENLCEGNPHTKVGSRKPPHA
QHRVHTWEKPDKCAECGRGFGQKPPLEQQRFHGVENLQESGKCTTSLAPRPDLGAYLPAH
AGHVPYICKECGKVFAQRSELTTHQKSHARQKPHKCQECGKAFFQALSLFRHQRTHTRGK
LYECGECGKGFSQKSTLAIHQKIHAGERQYVCGECGKAFTQKSALSLHRRIHSGEKAYVC
LACGQAFVQKAHLTVHQRSHTGEKPYKCSDCGRAFICKSQLDIHRRIHTGEKPYECRDCA
KAFTQKSHLNMHRKIHTGERQHVCRDCGKAFTQKSILNMHQRTHTGEKPYKCRDCGRAFT
AKSQFREHQRVHTGEKPYVCAECGKAFNGRSNFHKHQMTHTRGKTFACHTCGTAFGQKSE
LMAHRRTHVGQRPHECGDCGKSFSKKPQLQVHRRIHTGETPYACPQCGKAFNNRSNFNKH
QTTHTRDRPYESTSCMKGITQTS
Download sequence
Identical sequences ENSFCAP00000012702 9685.ENSFCAP00000012702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]