SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000012812 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000012812
Domain Number 1 Region: 58-147
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 9.16e-37
Family SCAN domain 0.0000378
Further Details:      
 
Domain Number 2 Region: 393-447
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.1e-21
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 451-504
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.87e-21
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 4 Region: 493-545
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-19
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 5 Region: 148-193
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000693
Family KRAB domain (Kruppel-associated box) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000012812   Gene: ENSFCAG00000013816   Transcript: ENSFCAT00000013821
Sequence length 555
Comment pep:novel genescaffold:CAT:GeneScaffold_3212:428:42790:-1 gene:ENSFCAG00000013816 transcript:ENSFCAT00000013821 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSLTASQVSDAEAGAWMAVEKSRVAAPSLRDGLLIVKVEEDSPGGRESDLPADCQDSE
KSRQQFRRFRYQEVAGPEEALSRLRELCRRWLRPEMHTKEQILELLVLEQFLSILPQELQ
AWVRKHCPQSGEKAAAVVRAFQRALDGASPQELVKIENVAVSLNCEEWEPLDPAPREFCW
ESAQEDHRTSVSLVSPSLETRTENKDFIPKQEILEEVEPQGQLQEGSHRKAPPGCSDTGE
IGVEKQSRNPSSLKLENSPEEEGLPCTADLKNGPTEEGDFRHDQLGNRARSSNSVCQXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXYQCQECGKRFSQSAALIKHQRTHTGEKPYTCPKCGDS
FRQSSHLTRHQRIHIGEKHFECHECGETCRISNRFRHQRIHKGERPYTCEECEKSFKRCS
DLSKHQRIHTGEKPYGCSVCGKRFSQSATLITHQRTHTGEKPYKCLECGESFRQSPHLIR
HQRIHRNKVPPFHGC
Download sequence
Identical sequences ENSFCAP00000012812 9685.ENSFCAP00000012812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]