SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000013216 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000013216
Domain Number 1 Region: 189-453
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.48e-81
Family Eukaryotic proteases 0.000000171
Further Details:      
 
Domain Number 2 Region: 108-149
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000419
Family EGF-type module 0.00064
Further Details:      
 
Domain Number 3 Region: 152-201
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000263
Family EGF-type module 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000013216   Gene: ENSFCAG00000014243   Transcript: ENSFCAT00000014247
Sequence length 466
Comment pep:novel genescaffold:CAT:GeneScaffold_4822:307572:320846:1 gene:ENSFCAG00000014243 transcript:ENSFCAT00000014247 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSGSRGPALLCSLLGLQASLAAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKQFWVSYVDGDQCASNPCQNG
GSCEDQLQSYICFCLDNFEGRNCETNKKDQLICVNENGGCEQYCSDHAETRRSCRCHEGY
ALQDDGVSCAPTVEYPCGRIPVLEKRNGRDPQGRIVGGKVCPKGECPWQAALKLDGVLVC
GGALLDAAWVVSAAHCFDRIRNWENLTVVLGEHDLRKEEGEEQERHVAQIIIPDKYIPRK
TNHDIALLRLRTPVAFTNHVVPLCLPEKSFSERTLAFIRFSTVSGWGQLLDRGITALELM
AIDVPRVMTQDCQEQSHRKAGSGITENMFCAGYLDGSKDACKGDSGGPHATKFQGTWYLT
GIVSWGEGCAAEGHFGVYTRVSQYIEWLRRLMSEPNPGGLLRAPLP
Download sequence
Identical sequences 9685.ENSFCAP00000013216 ENSFCAP00000013216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]