SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000013271 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000013271
Domain Number 1 Region: 367-424
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.72e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 2 Region: 228-284
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.43e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 283-340
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.04e-23
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 9-55
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.45e-19
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 5 Region: 148-198
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.93e-18
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 6 Region: 186-228
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000886
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 7 Region: 330-362
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000515
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 8 Region: 414-446
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000134
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000013271   Gene: ENSFCAG00000014307   Transcript: ENSFCAT00000014309
Sequence length 446
Comment pep:novel genescaffold:CAT:GeneScaffold_4773:41191:47011:1 gene:ENSFCAG00000014307 transcript:ENSFCAT00000014309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPRLPRAQIQGSLTFGDVAVAFTQIEWKHLDAAQRALYKDVMLENYGNLVSVXXXXXXX
XXXXXXXXXXXXXXXXXXQQVPSGTGSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXSFISHQRNHTGEKPHKCNECGIAFMSSSSLLN
HRKIHTGKQPYRCIECGKFLKKHSTFVNHQKIHSREKPHKCNECGKAFGKNSILLRHQRI
HTGQKPYKCNDCGKAFAQNVALTRHERIHSGEKPFTCKECGKAFRDNSTVLEHLKIHTGE
KPYQCNECGKTFRKSSTLVSHQRMHTGEKPYHCSKCGKSFRYSSSFAGHQKTHSGNKPYQ
CNDCGKVFTKSSTLIGHQRIHTGEKPYHCKKCGKSFRHSSGLVEHQRIHTGEKPYECNAC
GKAFPQSSALKQHKKMHNKERAIKCN
Download sequence
Identical sequences 9685.ENSFCAP00000013271 ENSFCAP00000013271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]