SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000013309 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000013309
Domain Number 1 Region: 422-523
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.93e-26
Family Protein kinases, catalytic subunit 0.0000131
Further Details:      
 
Domain Number 2 Region: 118-246
Classification Level Classification E-value
Superfamily SH2 domain 2.02e-23
Family SH2 domain 0.00011
Further Details:      
 
Domain Number 3 Region: 60-144
Classification Level Classification E-value
Superfamily SH3-domain 1.02e-17
Family SH3-domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000013309   Gene: ENSFCAG00000014347   Transcript: ENSFCAT00000014351
Sequence length 527
Comment pep:novel genescaffold:CAT:GeneScaffold_1477:88626:173859:-1 gene:ENSFCAG00000014347 transcript:ENSFCAT00000014351 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILSTYNTIQSIFCCCCCCSVQKRQVRTQISLSKDEEFSERYTPRRRLWFSELPSKKRAN
RGHMQPSKRKPLPPLPPSEVTEEKIQVKALYDFVPREPCDLALKRAEEYVILEKYNPHWW
KARDRLGNEGLIPSNYVTENKPTNLEIYXXXXXXXXXXXXXXXLRQESKEGAFIVRDSRH
LGSYTISVFIRDRRNMEATIKHYQIKKNDSGQWYVAERHLFQSIPELIWYHQHNAAGLMT
RLRYPVGLMGSCLPATAGFSYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYVLDDEY
ISSSGAKFPVKWSPPEVFHFNKYSSKSDVWSFGVLMWEVFTEGKMPFENKSNLQVVEAIS
KGFRLYRPQLAPMSIYEVMYGCWHEKPKGRPTFTELLQVLTEIAETW
Download sequence
Identical sequences ENSFCAP00000013309 9685.ENSFCAP00000013309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]