SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000013822 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000013822
Domain Number 1 Region: 486-581
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000245
Family C-type lectin domain 0.0065
Further Details:      
 
Domain Number 2 Region: 135-228
Classification Level Classification E-value
Superfamily Kelch motif 0.00000000157
Family Kelch motif 0.032
Further Details:      
 
Domain Number 3 Region: 792-836
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000013
Family Laminin-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000013822   Gene: ENSFCAG00000014901   Transcript: ENSFCAT00000014905
Sequence length 1158
Comment pep:novel genescaffold:CAT:GeneScaffold_1045:7094:313183:1 gene:ENSFCAG00000014901 transcript:ENSFCAT00000014905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLIVPEIRGNETVPEVVTTSCYALLHFFXXXXXXXXXXXXXXXINSCPNNCSGHGKCTTS
VSVPSQVYCECDKYWKGEACDIPYCKANCGSPDHGYCDLREKLCVCNDSWQGPDCSLNVP
STESYWILPNVKPFSPSVGRASHKAVLYGKFMWVIGGYTFNYSSFQMVLNYNLESSIWNV
GSLSRGPLQRYGHSLALHQLDSRDVVMIVIFGYSAIYGYTSSIQEYHIXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXPGNKYGLDDLYKYEVNTKTXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXSMYIFGGFSSVLLNDILVYKPPNCKAFRDEELCKNAGPGIKCIWNKNHCES
WESGNTNNILRAKCPPKTAAPDDRCYRYADCASCTANTNGCQWCDEKKCISANSNCSVSV
KNYTKCHVRNEQICNKLTSCKSCSLNLNCQWDQRQQECQALPAHLCGEGWNHIGDACLRI
NSSRESYDNAKLYCYNLSGNLASLTTSKEVEFVLDEIQKYTQQXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSPNQN
ARPCKKPCSLRTSCSNCTSNGMECMWCSSTRRCVDSNAYIISFPYGQCLEWQTATCSXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXSFIQCPACQCNGHSTCVNNNVCEQCKNLTTGNQCQDCMPGYYGDPTNGGQCTXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLLIDYQFTFSLLQ
EDDRHHTAINFIANPEQXXXXXXXXXXXXXXXXXXXXXXXXXXXGTISGEETPIVSKTNI
KEYRDSFSYEKFNFRSNPNITFYVYVSNFSWPIKIQIAFSQHNTIMDLVQFFVTFFXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLAIASALIDISQQKPSDSKDKT
SGVRNRKHHLSTRQGTCV
Download sequence
Identical sequences ENSFCAP00000013822 9685.ENSFCAP00000013822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]