SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000014004 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000014004
Domain Number 1 Region: 886-924
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000742
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000014004
Domain Number - Region: 1018-1102
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000141
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number - Region: 857-896
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000381
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000014004   Gene: ENSFCAG00000015098   Transcript: ENSFCAT00000015101
Sequence length 1247
Comment pep:novel genescaffold:CAT:GeneScaffold_537:236222:309466:-1 gene:ENSFCAG00000015098 transcript:ENSFCAT00000015101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESSTKPHIENITIDQNQMDFSTVVSKEGVMTQIPRKSHTSSDAPENFIPQTEAADARGRN
DSSRKTNFTISPVGSDTATALTSQSLTRALGTLRSPSSSGSEGRTAPSHTESGTSQGSLA
RGKQLPEDMTVHTQLAATWVFSQDPLPALEMEEETMLSRKRNFSGPALSRTPAHSPPSDH
PGSSGSTEMLNNSTTFQNTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLGGE
QVASSSDAEDGSPMSQTETVSRSVLSGRSGASTARWFLTNSKTFADATGSSTSYPEVVNA
SVLTRFSASVSQSRGSDAALGDRSYSEPATESLSSSSSESLDSSAARGECSITGISYSQV
SGTDFEQKASSDYADHTYVSSTFTKGERALLSIVDNSSTPDIRESSTSSVKISNSSHSDY
SSSSQAQTERSNVSSYEGEYAQPSTESLALRTANLPSYTSTINMPNTLVLLDADAGSIGN
SSSSSSSSSSSSSSGPPLPLPSVSQSHQSFSSILPSTGASTLPLQSTPHAPTPVSSSPAS
LTASTPASPSTSQTTLAPSPSTLVLPVTPQTATXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXDRCATNPCLHDSSVDSSSGCMCSPSWQGDDCSMDVNECLLNPC
PPLAMCNNTQGSYTCKCPVGYQLEKGICNLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXLNVCFSMFPGYTRSTVHASRESSAVVMSLQTTFSLASNVTLFDLADGMQKCVNSC
RSSAEVCQLLGSQRRIFRAGSLCKRKTPECDKETSICTDLDGVALCQCKSGYFQFNKMDH
SCRACEDGYRLENETCMSCPFGLGXXXXXXXYQLITVVIAAAGGGLLLILGIALIVTCCR
KSKNDISKLIFKSGDFQMSPYAEYPKNPRSQDWGREAIEMHENGSTKNLLQMTDVYYSXX
XXXXXXXXXNGLYPAYTGLPGSRHSCIFPGQYNPSFISDESRRRDYF
Download sequence
Identical sequences ENSFCAP00000014004 9685.ENSFCAP00000014004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]