SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000014493 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000014493
Domain Number 1 Region: 63-107
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000629
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000014493
Domain Number - Region: 506-633
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0011
Family Rhodopsin-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000014493   Gene: ENSFCAG00000015628   Transcript: ENSFCAT00000015632
Sequence length 650
Comment pep:novel genescaffold:CAT:GeneScaffold_1893:285:89939:-1 gene:ENSFCAG00000015628 transcript:ENSFCAT00000015632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQGPSLLPGLCFLLSLSEVMAQMTKAATCPQCPQHAFCVHGTYCTCDSGYASDSGKKFFT
FPLETCNDIDECKPPISIYCGLNAACQNVEGSFHCHCNPGYKLLSGDTQFENSNANTCQK
TTSSKTTRDTEELQRVVEKFESLLTNDTPWAMGEKREVASWATTLFQTVESSVLETALKS
PEQKIQKIHNSTVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPTAIAF
ISYSSLGNIINATFFEEANGKDRVYLNSQVVSAAIGPERNTSLPKSVILSFQHVKMKPSS
EKAVCVYWKSTNEGGQWSSDGCFLIQANKSHTICNSTHLSSFAVLVALTHQEEDPVLVVI
TYVGLGLSLLCLLLAALTFLLCKAIQNTSTSLHLQLSICLFLAHLLFLTAIDQTKIKLLC
AIIAGALHYLYLASFTWMLLDGLHLFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXCWLHTDKGFVWTFLGPVCTIFSINLAFFLMTFWIVKNKLSSLNR
DVSTLQNTRMLTFKATAQLLILGCTWCLGVLQVGPAARVMAYLFTIINSLQGAFIFLVYC
LLSQQVRKWFREIMKSKPESETYTLSTRFGTNSRPSEGDVFPEQLKRKYS
Download sequence
Identical sequences 9685.ENSFCAP00000014493 ENSFCAP00000014493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]