SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000015513 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000015513
Domain Number 1 Region: 204-234
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000215
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000015513
Domain Number - Region: 6-35
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0227
Family EGF-type module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000015513   Gene: ENSFCAG00000019061   Transcript: ENSFCAT00000018144
Sequence length 314
Comment pep:novel genescaffold:CAT:GeneScaffold_310:676:60070:1 gene:ENSFCAG00000019061 transcript:ENSFCAT00000018144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LNVRESDVRVCDESSCKYGGVCKEDGDGLKCACQXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXNGSGSGEGEEEGSGAEVHRKHSKCGPCKYKAECDEDAENV
GXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTDDTSLLGK
KDDGLQYRPDVKDASDQREDVYIGNHMPCPENLNGYCIHGKCEFIYSTQKASCXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKCPKNNRGRRQKQ
NLGHFTSDTSSRMV
Download sequence
Identical sequences 9685.ENSFCAP00000015513 ENSFCAP00000015513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]