SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000015604 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000015604
Domain Number 1 Region: 3808-4008
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.9e-38
Family Laminin G-like module 0.0043
Further Details:      
 
Domain Number 2 Region: 3325-3436
Classification Level Classification E-value
Superfamily Cadherin-like 6.14e-32
Family Cadherin 0.00061
Further Details:      
 
Domain Number 3 Region: 3219-3324
Classification Level Classification E-value
Superfamily Cadherin-like 3.57e-30
Family Cadherin 0.00074
Further Details:      
 
Domain Number 4 Region: 2805-2913
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-26
Family Cadherin 0.0011
Further Details:      
 
Domain Number 5 Region: 708-837
Classification Level Classification E-value
Superfamily Cadherin-like 6.84e-25
Family Cadherin 0.0012
Further Details:      
 
Domain Number 6 Region: 456-557
Classification Level Classification E-value
Superfamily Cadherin-like 6.14e-22
Family Cadherin 0.00084
Further Details:      
 
Domain Number 7 Region: 3429-3533
Classification Level Classification E-value
Superfamily Cadherin-like 1.16e-21
Family Cadherin 0.0015
Further Details:      
 
Domain Number 8 Region: 1052-1137
Classification Level Classification E-value
Superfamily Cadherin-like 5.85e-21
Family Cadherin 0.0014
Further Details:      
 
Domain Number 9 Region: 2913-3003
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-16
Family Cadherin 0.0011
Further Details:      
 
Domain Number 10 Region: 561-662
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000671
Family Cadherin 0.0015
Further Details:      
 
Domain Number 11 Region: 2609-2696
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000571
Family Cadherin 0.003
Further Details:      
 
Domain Number 12 Region: 1131-1193
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000257
Family Cadherin 0.0025
Further Details:      
 
Domain Number 13 Region: 2705-2803
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000257
Family Cadherin 0.0042
Further Details:      
 
Domain Number 14 Region: 3119-3218
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000171
Family Cadherin 0.0015
Further Details:      
 
Domain Number 15 Region: 3078-3125
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000171
Family Cadherin 0.0054
Further Details:      
 
Domain Number 16 Region: 4035-4163
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000879
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 17 Region: 3538-3627
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000002
Family Cadherin 0.0081
Further Details:      
 
Domain Number 18 Region: 4010-4047
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000128
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000015604   Gene: ENSFCAG00000018246   Transcript: ENSFCAT00000019187
Sequence length 4352
Comment pep:novel genescaffold:CAT:GeneScaffold_553:37997:167882:-1 gene:ENSFCAG00000018246 transcript:ENSFCAT00000019187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRLVALLLLLLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLGANSNPPEFTQTAYKASFDENVPIGTT
VLSVSAVDPDEGENGYVTYSIANLNHVPFVINHFTGAVSTSENLDYELMPRVYTLRIRAS
DWGLPYRREVEVLATVTLNNLNDNTPLFEKINCEGTIPRDLGVGEQITTVSAIDADELQL
VRYQIEAGNELDLFSLNPSSGVLSLKQSLLDGLGTKVSFHSLRITATDGENFATPLYINI
TVAASRKPVHLQCEETGVAKMLAEKLLQANKLHSQGEVEDIFFDSHSVNAHAPQFRSTLP
AGVEVKENHPVGASIIFMNATDLDTGFNGKLVYAISGGNEDSCFVIDMETGMLKILSPLD
RETTDKYTLNITASDLGIPQKAAWRLVDIRVLDANDNPPEFLQESYFVEVSEDKEVDSEI
IQVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTVSAHDEDTGEDGEIRYSIRDGSGVGV
FKIDEETGVIETSDGLDRESTSHYWLTVYAADRGVVPLSSFIEIYIEVEDVNDNAPQTSE
PVYYPEIIENSPKDVSVVQIEAFDADSSSNDKLTYKITSGNPQGFFSIHPKTXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXSSAPKGTSVIKVLASDADEGSNADVTYAIEAD
SESVKENLEINKLSGIITTKESLIGLENEFFTFFVRAVDSGSPSRESVVPVYVKILPPEI
QLPKFSEPFYTYTVSEDMPIGTEIDLIRAEHSGTVLYSLIKGNTPESNRDEFFVIDRQSG
RLKLEKSLDHETTKWYQFSILARCAHEDYEVVASVDVSIQVKDANDNSPVLESNPYEAFI
VENLPGGSRVIQARASDLDSGTNGQVMYSLDQSQSVEVIESFAINMETGWITTLKELDHE
ERDHYQIKVVASDHGEKVQLSSTAIVDVTVTDVNDSPPRFTAEIYKGTVSEDDPPGGVIA
ILSTTDADSEEINRQVTYYITGGDPLGQFAIEIQNEWKVFVKKPLDRTRDNYLLTITATD
GTFSSKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXELKTLAPLDREEQAVYNLLVKATDGGGRFCQASIVLTLEDVND
NAPEFSADPHAITVFENTEPGTLLTRVQATDADAXXXXXXXXXXXXXXXXXXXINEFSGI
QEKLLDREVRVYTLLKAVDQGLPRRLTATGTVVVSVLDINDNPPVFEYREYGATVSEDIL
LGTEVLQVYAASRDIEANAEITYAIISGNEHGKFSIDSKTGAIFIIENLDYESSHEYYLT
VEATDGGTPSLSDVATVSINVTDVNDNSPVFSQDTYTAVISEDAVLEQSVITVMADDADG
PSNSHIRYSITDGNQGSPFTIDPARGEVKVTRLLDRETISGYTLTVQASDNGSPPRVNTT
TVNIDVSDVNDNAPVFSKGNYSVIIQENKPVGFSVLQLVVTDRDSSHNGPPFFFTVVSGN
DDGVFEVNQQGVLLTSAAIKRKVKDHYLLHVKVADNGKPQLSSLTYIDIRVIEESVYPPA
ILPLEIFITAFGEEYSGGVIGKIHATDQDVYDTLSYSLDPQMGNLFSVSSTGGKLIAHRK
LDVGQYLLNVSVTDGKFTTVADITVHIRQITQEMLNHTVAVRFANLTPEEFVGDYWRNFQ
RALRNILGVRRSDVQIVSLQPSEPHPHLDVLLFVEKSGSAQVSTKLLLHKINSSVTDLEE
IMGVRILDVFQKLCAGLDCPWKFCDEKVTVDENVMSTHSTARLSFVTPRHHRTAVCLCQE
GRCPVVHHGCEDSPCPEGSECIADPREEKYACVCPGGKFGQCPGSSSVTFTGNSFVKYRL
MENENRLEMKLTMRLRTYSAHAVVMYARGTDYSILEIHNGRLQYKFDCGSGPGIVSVQSI
QVNDGLWHAVSLEVNGNYARLVLDQVHTASGTAPGTLKTLNLDNHVFFGGHIRQQGTRHG
RSPQVGNGFRGCMDSIYLNGQELPLNNKPRSHAHIEEWVDVSPGCLLTATEDCSSNPCQN
GGVCQPSPTGGYYCKCSALYIGTYCELSVNPCSSNPCLYGGTCIVDNGDFLCQCRGLYTG
QRCQLSPYCKDEPCKNGGTCFDSLDGAVCQCDSGFRGERCQSDIDECAASPCRNGALCEN
THGSYHCNCSHDYRGKHCEDAAPNQYVSTPWNIGLAEGIGILVFVTGIFLLAVVFVLCRK
MISRKKKHQAEPEDKHLGPTTAFLQRPYFDSKLNKNIYSDIPPQVPVRPISYTPSIPSDS
RNNLDRNSFEGSAIPEHPGVPAFDPESVHHQKALAVCTVAPALPPPQPSTSPSDIYSFPK
PAWDFHYDTKVVDLDPCLKKPLEEKPSHPYSA
Download sequence
Identical sequences ENSFCAP00000015604 9685.ENSFCAP00000015604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]