SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|189911523|ref|YP_001963078.1| from Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|189911523|ref|YP_001963078.1|
Domain Number 1 Region: 441-664
Classification Level Classification E-value
Superfamily Fibronectin type III 3.95e-19
Family Fibronectin type III 0.0066
Further Details:      
 
Domain Number 2 Region: 896-944
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000209
Family TSP-1 type 1 repeat 0.0009
Further Details:      
 
Domain Number 3 Region: 783-877
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000908
Family Fibronectin type III 0.008
Further Details:      
 
Weak hits

Sequence:  gi|189911523|ref|YP_001963078.1|
Domain Number - Region: 668-760
Classification Level Classification E-value
Superfamily PKD domain 0.00275
Family PKD domain 0.017
Further Details:      
 
Domain Number - Region: 294-350
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00523
Family TSP type-3 repeat 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|189911523|ref|YP_001963078.1|
Sequence length 1054
Comment lipoprotein [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
Sequence
MKRIISTFVMSQLLVSCIAFLDFSKEADKKLESLGLVATSALNVGSATAGPSGKSITSDD
GKFQVLIPPGAMDEEKTFSIRRFEITNSSLPNGYIPTTDAYEITPSYRFKKDVVITISQN
VEKIEALNLAKNKAQGFVNSTTSDSDNSGRVSGGWDGSLTTASSDKIQFQSRTFSIFGGG
TPPPGNGAPNIVGAFYDFKPGSSFLPFRVRAQVIEPDGDVMSVYLITGPVGQGTVAIRMV
PEPGNWYSALIPYESMVQAGIQIQVLAVDSYGNNTTRPSSDMFFYPVSSGNPAFVNNYDT
DKDNDGYLDAWEGDNGFNPNNPSSPNAALFPDSDGDGIPNVADHTPNGEANPQIDSISVI
PNQARMYLDEKITFSILASYLGSPRYVQSNFVTTGNALSGSPVGEFSDSVFQAIAPGIAG
VQVTVGNFQATSTVTVVDTVPPNNITTLTAIAMSATRVRLRWQAPGNDGPFGKVSAYEIR
RSSNNIDTDAKCSQASTIFHTLTPKNAGSVEIWDANGHAPNTTYYYCIRAYDHNGNRNEW
VSSNVSATTYVVGDTVRPSDVTTLTANALTDETVQLFWTAVGDDGTVGNASSYEIRRSAS
VINTDADCDNSHEVTNSISAVTVGTNINFLVTQLSANTQYYFCVRAYDEVGNKSRWNGTV
SATTLLGNIPPIANAGLDQMNAMVGTQVNLNGTQSYDPDSGVCSANPASYVYQWSIISKP
PSSNLTNGQINSGNQLNASFTPDVPGQYALELRFTDSSSTCFGGPRMGSDIMQVTAYESD
LIPPAQVTSFLGTGISQDQIQLTWLNVGDDGMTGNINRYEIGISINPITNDTECQNAPWK
HSPNISNFVPNAQVSAVIGGLFQNTTYHLCIIGFDEVANRGQANVGLSVTTIAGTSGWGE
WTQWSNCSARCGAGTRTRTRTCLDPIAGCGGTNTETTACNLRNCYSNISVANNAANDTSH
TLVCPTNYVRGPNMSVHVYTGLFKKHVSDWFALGCGLYRGYTIVPNESTYTVTDIQNGVR
IDFALPHPPPEDYPCTSNELYTNRNTAIYCSEVP
Download sequence
Identical sequences 355278.LBF_2000 WP_012476306.1.33202 WP_012476306.1.95533 gi|189911523|ref|YP_001963078.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]